UniGene Name: sp_v3.0_unigene164958
Length: 223 nt
UniGene Fasta |
---|
>sp_v3.0_unigene164958
C |
Ace file of the UniGene sp_v3.0_unigene164958 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Early embryogenesis aquaglyceroporin n=1 Tax=Pinus taeda RepID=Q940D9_PINTA | - | - | 2.0e-23 | 73% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
Sma3 | Aquaporin, MIP family, NIP subfamily | - | - | 1.581e-16 | - |
Source | Gene names |
---|---|
Sma3 | AcMip1; At1g80760; At4g10380; At4g19030; At5g37810; At5g37820; F13C5.200; F23A5.11; F24G24.180; GSVIVT00000446001; GSVIVT00011149001; GSVIVT00035815001; HvLsi1; K22F20.50; K22F20.60; LOC_Os02g13870; LOC_Os02g51110; LOC_Os05g11560; LOC_Os06g35930; LSI1; NI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | Casparian strip | GO:0048226 | Cellular Component | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | arsenite transmembrane transporter activity | GO:0015105 | Molecular Function | 0.0 | - |
Sma3 | silicate transmembrane transporter activity | GO:0015115 | Molecular Function | 0.0 | - |
Sma3 | glycerol transmembrane transporter activity | GO:0015168 | Molecular Function | 0.0 | - |
Sma3 | urea transmembrane transporter activity | GO:0015204 | Molecular Function | 0.0 | - |
Sma3 | water channel activity | GO:0015250 | Molecular Function | 0.0 | - |
Sma3 | borate transmembrane transporter activity | GO:0046715 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | response to boron-containing substance | GO:0010036 | Biological Process | 0.0 | - |
Sma3 | arsenite transport | GO:0015700 | Biological Process | 0.0 | - |
Sma3 | silicate transport | GO:0015708 | Biological Process | 0.0 | - |
Sma3 | response to arsenic-containing substance | GO:0046685 | Biological Process | 0.0 | - |
Sma3 | borate transport | GO:0046713 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Major intrinsic protein | IPR000425 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Aquaporin | IPR012269 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G80760.1 | " NIP6;1, NIP6, NLM7 NOD26-like intrinsic protein 6;1 chr1:30350640-30352015 REVERSE LENGTH=305" | 2.0e-21 | 57% |
RefSeq | Arabidopsis thaliana | NP_178191.1 | aquaporin NIP6-1 [Arabidopsis thaliana] | 2.0e-21 | 57% |
RefSeq | Populus trichocarpa | XP_002305717.1 | aquaporin, MIP family, NIP subfamily, partial [Populus trichocarpa] | 2.0e-23 | 55% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P2J2
Fln msg: Distance to subject end: 120 aas, your sequence is shorter than subject: 73 - 280
Fln protein:
V
Protein Length:
74
Fln nts:
C
Fln Alignment:
HA8LWWM01ELOFH___VMIIIYAIGHISGAHLNPAVTLASALVRRFPWAQVPAYIGAQVIAAISAGFVLRLMFGEVTHIAATVPTGSDM
A9P2J2________________VMIIIYSIGHISGAHLNPAVTLAFAAVRRFPWTQVPAYIGAQVFAAICAGFVLRLMFGDVAYIAATVPSGSDM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain