|
||||||
|
UniGene Name: sp_v3.0_unigene164928
Length: 191 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene164928
T |
|
Ace file of the UniGene sp_v3.0_unigene164928
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | phosphatidylinositol 3-kinase [Brassica napus] | - | - | 2.0e-21 | 80% |
| FL-Next | sp=Phosphatidylinositol 3-kinase, root isoform; Glycine max (Soybean) (Glycine hispida). | - | - | 0.0 | 81% |
| Sma3 | Phosphatidylinositol 3-kinase | - | - | 7.708e-11 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphatidylinositol 3-kinase. | EC:2.7.1.137 | - | 4.405e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Inositol phosphate metabolism | 00562 | 4.405e-11 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.405e-11 | % | |
| Sma3 | Phosphatidylinositol signaling system | 04070 | 4.405e-11 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g60490; CHLREDRAFT_196943; F8A5.4; GSVIVT00002733001; MICPUCDRAFT_42284; MICPUN_88102; OSJNBa0024A05.11; OSTLU_34142; Os05g0180600; Os08g0307400; OsI_28732; OsJ_17344; OsJ_26836; P0453H11.6; PHYPADRAFT_182554; PI3K; PI3K1; POPTRDRAFT_806443; RCOM_05280 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | phosphatidylinositol 3-kinase complex | GO:0005942 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | inositol or phosphatidylinositol kinase activity | GO:0004428 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | 1-phosphatidylinositol-3-kinase activity | GO:0016303 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | immune response | GO:0006955 | Biological Process | 0.0 | - |
| Sma3 | antigen processing and presentation | GO:0019882 | Biological Process | 0.0 | - |
| Sma3 | phosphatidylinositol phosphorylation | GO:0046854 | Biological Process | 0.0 | - |
| Sma3 | phosphatidylinositol-mediated signaling | GO:0048015 | Biological Process | 0.0 | - |
| Sma3 | microgametogenesis | GO:0055046 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | C2 calcium-dependent membrane targeting | IPR000008 | - | 0.0 | - |
| Sma3 | Phosphatidylinositol 3-/4-kinase, catalytic domain | IPR000403 | - | 0.0 | - |
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Phosphoinositide 3-kinase, accessory (PIK) domain | IPR001263 | - | 0.0 | - |
| Sma3 | Phosphoinositide 3-kinase, C2 | IPR002420 | - | 0.0 | - |
| Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
| Sma3 | Small GTPase superfamily, ARF/SAR type | IPR006689 | - | 0.0 | - |
| Sma3 | Phosphatidylinositol 3-kinase, Vps34 type | IPR008290 | - | 0.0 | - |
| Sma3 | Phosphatidylinositol Kinase | IPR015433 | - | 0.0 | - |
| Sma3 | Phosphatidylinositol 3/4-kinase, conserved site | IPR018936 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G60490.1 | ATVPS34, VPS34, PI3K vacuolar protein sorting 34 chr1:22285792-22290190 REVERSE LENGTH=814 | 6.0e-26 | 79% |
| RefSeq | Arabidopsis thaliana | NP_176251.1 | phosphatidylinositol 3-kinase VPS34 [Arabidopsis thaliana] | 8.0e-26 | 79% |
| RefSeq | Populus trichocarpa | XP_002318628.1 | predicted protein [Populus trichocarpa] | 3.0e-26 | 81% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P42347
Fln msg: Distance to subject end: 409 aas, your sequence is shorter than subject: 63 - 814
Fln protein:
F
Protein Length:
64
Fln nts:
T
Fln Alignment:
HA8LWWM01AN4YJ___RWAPIDTADALELLSPLFKSEEVRAYAVNVLERAEDEELQCYLLQLVQALRFERSEKSRLA
P42347________________KWEMIDVCDALELLSPVFESEEVRAYAVSVLERADDEELQCYLLQLVQALRFERSDKSRLS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
