UniGene Name: sp_v3.0_unigene164868
Length: 204 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene164868
G |
Ace file of the UniGene sp_v3.0_unigene164868 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative transposase n=1 Tax=Arabidopsis thaliana RepID=O81190_ARATH | - | - | 2.0e-17 | 64% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
Source | Gene names |
---|---|
Sma3 | GSVIVT00000858001; GSVIVT00001200001; GSVIVT00002236001; GSVIVT00017198001; GSVIVT00031489001; GSVIVT00034220001; VITISV_009403; VITISV_009724; VITISV_015896; VITISV_016801; VITISV_021604; VITISV_031335; VITISV_032284; VITISV_035916; VITISV_037171; VITISV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | drug transmembrane transporter activity | GO:0015238 | Molecular Function | 0.0 | - |
Sma3 | antiporter activity | GO:0015297 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | drug transmembrane transport | GO:0006855 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycoside hydrolase, family 1 | IPR001360 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Multi antimicrobial extrusion protein | IPR002528 | - | 0.0 | - |
Sma3 | Zinc finger, BED-type predicted | IPR003656 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | HAT dimerisation | IPR008906 | - | 0.0 | - |
Sma3 | IPR011523 | - | 0.0 | - | |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2-like | IPR015880 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G33406.1 | hAT dimerisation domain-containing protein / transposase-related chr5:12676126-12678403 REVERSE LENGTH=509 | 3.0e-20 | 56% |
RefSeq | Arabidopsis thaliana | NP_680299.4 | hAT family dimerization domain-containing protein [Arabidopsis thaliana] | 3.0e-20 | 56% |
RefSeq | Populus trichocarpa | XP_002302801.1 | predicted protein [Populus trichocarpa] | 2.0e-17 | 46% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADK7
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 109 aas, your sequence is shorter than subject: 54 - 250
Fln protein:
A
Protein Length:
55
Fln nts:
G
Fln Alignment:
HA8LWWM01CHD6Z___AY*WQQFGSECPQLQKFAIQILSQTCSA*GCKQNWSVFEHIHTKKRNHLEQK*LNDMVFIQYNLRLR
D5ADK7________________AYWWQQFGSQCHELHKFAVRILSQTCSAFGCERNWSVFERIHTKKRNRLEQKRLNDIVFVQCNLRLR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain