UniGene Name: sp_v3.0_unigene164850
Length: 226 nt
UniGene Fasta |
---|
>sp_v3.0_unigene164850
C |
Ace file of the UniGene sp_v3.0_unigene164850 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=Probable xyloglucan glycosyltransferase 7; AltName: Full=Cellulose synthase-like protein C7; AltName: Full=OsCslC7 gb|AAT44138.1| putative glucosyltransferase [Oryza sativa Japonica Group] | - | - | 4.0e-15 | 66% |
FL-Next | sp=Xyloglucan glycosyltransferase 4; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 67% |
Sma3 | Transferase, transferring glycosyl groups, putative | - | - | 8.181e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 2.455e-26 | - |
Source | Gene names |
---|---|
Sma3 | At2g24630; At3g07330; At3g28180; At4g07960; At4g31590; CSLC1; CSLC10; CSLC12; CSLC2; CSLC3; CSLC4; CSLC5; CSLC6; CSLC7; CSLC8; CSLC9; CslC1; CslC2; CslC3; F1K3.3; F21O3.4; F25P17.7; F28M20.220; GSVIVT00000743001; GSVIVT00008341001; GSVIVT00014999001; GSVI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | transferase activity, transferring glycosyl groups | GO:0016757 | Molecular Function | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycosyl transferase, family 2 | IPR001173 | - | 0.0 | - |
Sma3 | Inorganic pyrophosphatase | IPR008162 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G28180.1 | ATCSLC04, CSLC04, ATCSLC4, CSLC4 Cellulose-synthase-like C4 chr3:10506110-10509067 FORWARD LENGTH=673 | 9.0e-20 | 67% |
RefSeq | Arabidopsis thaliana | NP_566835.1 | xyloglucan glycosyltransferase 4 [Arabidopsis thaliana] | 1.0e-19 | 67% |
RefSeq | Populus trichocarpa | XP_002320599.1 | predicted protein [Populus trichocarpa] | 3.0e-24 | 73% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LJP4
Fln msg: Distance to subject end: 89 aas, your sequence is shorter than subject: 74 - 673
Fln protein:
R
Protein Length:
75
Fln nts:
C
Fln Alignment:
HA8LWWM01A8ML4___RSFPFVVPYLLFENKMSVTKFNARKIQCQDLWALSQLGSACEWVVTKKLGRSSEADLVAFMEKE
Q9LJP4________________KSFPFLVPYLLFENTMSITKFNAM------ISGLFQFGSAYEWVVTKKTGRSSESDLLAFAEKE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain