UniGene Name: sp_v3.0_unigene164803
Length: 217 nt
UniGene Fasta |
---|
>sp_v3.0_unigene164803
G |
Ace file of the UniGene sp_v3.0_unigene164803 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
Source | Gene names |
---|---|
Sma3 | At3g22690; At4g02750; At4g13650; F18A5.40; GSVIVT00004379001; GSVIVT00006973001; GSVIVT00007631001; GSVIVT00007922001; GSVIVT00011403001; GSVIVT00011842001; GSVIVT00013464001; GSVIVT00013634001; GSVIVT00014293001; GSVIVT00020069001; GSVIVT00025485001; GSV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | RNA modification | GO:0009451 | Biological Process | 0.0 | - |
Sma3 | thylakoid membrane organization | GO:0010027 | Biological Process | 0.0 | - |
Sma3 | photosystem II assembly | GO:0010207 | Biological Process | 0.0 | - |
Sma3 | regulation of chlorophyll biosynthetic process | GO:0010380 | Biological Process | 0.0 | - |
Sma3 | photosystem I assembly | GO:0048564 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Uncharacterised protein family UPF0497, trans-membrane plant | IPR006702 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G15300.1 | Pentatricopeptide repeat (PPR) superfamily protein chr5:4968384-4970030 REVERSE LENGTH=548 | 3.0e-21 | 50% |
RefSeq | Arabidopsis thaliana | NP_197034.2 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 4.0e-21 | 50% |
RefSeq | Populus trichocarpa | XP_002321443.1 | predicted protein [Populus trichocarpa] | 3.0e-23 | 53% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 147 aas, your sequence is shorter than subject: 72 - 246
Fln protein:
*
Protein Length:
73
Fln nts:
G
Fln Alignment:
HA8LWWM01ENUD2___DAENIIERMPFKPNAVIWQTLLGACRVHGNMEIGKHAAECILDLKPHDSASYVLLSNIYAAADRWDDVEKV
D5AAE0________________EARDFMKTIPFAPDANVWGALLGACRMYGNIDLGKHAAECLFQLEPHNAAKYVLLSNIYAAAGRWDDVAKV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain