UniGene Name: sp_v3.0_unigene164782
Length: 205 nt
![]() |
---|
>sp_v3.0_unigene164782
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | [R] COG2940 Proteins containing SET domain | - | - | 4.0e-09 | 41% |
FL-Next | sp=Histone-lysine N-methyltransferase CLF; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 95% |
Sma3 | Enhancer of zeste, ezh, putative | - | - | 1.624e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Histone-lysine N-methyltransferase. | EC:2.1.1.43 | - | 4.409e-19 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Lysine degradation | 00310 | 4.409e-19 | % |
Source | Gene names |
---|---|
Sma3 | At1g02580; At2g23380; At4g02020; CLF; EMB173; EZ1; EZ2; EZ3; EZA1; F26B6.3; FIS1; GSVIVT00019523001; GSVIVT00028115001; ICU1; LOC_Os03g19480; MEA; MEDEA; MEZ1; MEZ2; MEZ3; MICPUCDRAFT_59369; MICPUN_63548; Os03g0307800; Os06g0275500; OsI_11249; OsI_22514; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | histone-lysine N-methyltransferase activity | GO:0018024 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | regulation of gene expression by genetic imprinting | GO:0006349 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
Sma3 | DNA mediated transformation | GO:0009294 | Biological Process | 0.0 | - |
Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
Sma3 | endosperm development | GO:0009960 | Biological Process | 0.0 | - |
Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
Sma3 | GO:0016481 | Biological Process | 0.0 | - | |
Sma3 | histone methylation | GO:0016571 | Biological Process | 0.0 | - |
Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
Sma3 | von Willebrand factor, type C | IPR001007 | - | 0.0 | - |
Sma3 | SET domain | IPR001214 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase active site | IPR006650 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G23380.1 | CLF, ICU1, SDG1, SET1 SET domain-containing protein chr2:9955570-9960117 FORWARD LENGTH=902 | 4.0e-39 | 95% |
RefSeq | Arabidopsis thaliana | NP_179919.1 | histone-lysine N-methyltransferase CLF [Arabidopsis thaliana] | 6.0e-39 | 95% |
RefSeq | Populus trichocarpa | XP_002310129.1 | SET domain protein [Populus trichocarpa] | 3.0e-39 | 95% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P93831
Fln msg: Distance to subject end: 53 aas, your sequence is shorter than subject: 68 - 902
Fln protein:
T
Protein Length:
69
Fln nts:
A
Fln Alignment:
HA8LWWM01DP2RO___TGELISHKEADKRGKIYDREDSSFLFNLNDQFVLDAYRKGDKLKFANHSPNPNCYAKVIMVAGDHRVG
P93831________________TGELISHKEADKRGKIYDRENCSFLFNLNDQFVLDAYRKGDKLKFANHSPEPNCYAKVIMVAGDHRVG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain