UniGene Name: sp_v3.0_unigene164779
Length: 229 nt
![]() |
---|
>sp_v3.0_unigene164779
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Retrotransposon protein, putative, unclassified n=2 Tax=Oryza sativa RepID=Q10RT1_ORYSJ | - | - | 7.0e-16 | 58% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 59% |
Sma3 | Putative retroelement | - | - | 1.819e-08 | - |
Source | Gene names |
---|---|
Sma3 | B1234D02.7; H0306B06.3; H0502G05.6; LOC_Os03g05340; LOC_Os03g05350; LOC_Os03g23200; LOC_Os10g12630; LOC_Os10g16720; LOC_Os10g16880; LOC_Os10g17560; LOC_Os10g24460; LOC_Os10g24620; LOC_Os11g12880; LOC_Os11g20270; LOC_Os12g20250; LOC_Os12g24780; LOC_Os12g28 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | carbonate dehydratase activity | GO:0004089 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | carbon utilization | GO:0015976 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Carbonic anhydrase | IPR001765 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Intron-encoded nuclease 2 | IPR003611 | - | 0.0 | - |
Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF834 | IPR008552 | - | 0.0 | - |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
Sma3 | Carbonic anhydrase, prokaryotic-like, conserved site | IPR015892 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5BT42
Fln msg: Distance to subject end: 398 aas, your sequence is shorter than subject: 76 - 1365
Fln protein:
M
Protein Length:
77
Fln nts:
A
Fln Alignment:
HA8LWWM01EZZQ8___GRIAAPLTTLLKKDAFSWTPEARKAFEHLKEAMCQALVLATLDFTKTFIVECDASGNGIGVVLMQDERSIAF
A5BT42________________GKIVAPLIDMLRKNAFSWSQKAEEAFELLKQTMMQAPVLALPNFQLLFVVECDASGNGLGAVLMQEQRSIAY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain