SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene164778

Length: 255 nt

UniGene Fasta

>sp_v3.0_unigene164778
ACATGGTCCAGTCTACAAGGGCAGTTTGGATGATACCACTGTGGCCATCAAGGTTCTCGCTACAGATGCAGATAGAAACACAGATGAATTCAAACGGGAGATTGAGGTTCTAAGCTGCATAAATCACCCCAACTTAGTTCTGCTGCTTGGCACTTGCCTCGAACGCGGGTGTTTAGTTTATGAATATATGGAAAATGGCAGTCTAGAAGATCAGTTGTTCCACGGGGGATGGAAGAGCTTCTCTTCCTTGGTATA

Ace file of the UniGene sp_v3.0_unigene164778

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	similar to eukaryotic protein kinase domains (Pfam: pkinase.hmm, score: 171.43) [Arabidopsis thaliana]	-	-	4.0e-22	65%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	48%
Sma3	E3 ubiquitin ligase	-	-	6.864e-16	-

Source	ECs	Term	Type	e value	Identity
Sma3	Non-specific protein-tyrosine kinase.	EC:2.7.10.2	-	6.358e-07	-
Sma3	Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases.	EC:2.7.11.-	-	3.062e-10	-
Sma3	Ligases, Forming carbon-nitrogen bonds, Acid--D-amino-acid ligases (peptide synthases).	EC:6.3.2.-	-	4.081e-06	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Tryptophan metabolism	00380		4.081e-06	%
Sma3	Biosynthesis of siderophore group nonribosomal peptides	01053		4.081e-06	%

Source	Gene names
Sma3	At1g17540; At1g78940/YUP8H12R_26; At2g07020; At2g19410; At2g24370; At3g20200; At3g20200/MAL21_24; At4g25160; At4g31230; At5g12000; At5g51270; At5g57035; At5g61550; At5g61560; B1097D05.17; CDPK1; F13M23.300; F14F18_170; F17F16.3; F24A6.13; F27F23.21; F28P2

Source	GOs	Term	Type	Identity
Sma3	ubiquitin ligase complex	GO:0000151	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	protein kinase activity	GO:0004672	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	ubiquitin-protein ligase activity	GO:0004842	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	calcium ion binding	GO:0005509	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	response to stress	GO:0006950	Biological Process	-
Sma3	protein ubiquitination	GO:0016567	Biological Process	-
Sma3	modification-dependent protein catabolic process	GO:0019941	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	EGF-type aspartate/asparagine hydroxylation site	IPR000152	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Epidermal growth factor-like domain	IPR000742	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	EGF-like calcium-binding	IPR001881	-	-
Sma3	U box domain	IPR003613	-	-
Sma3	UspA	IPR006016	-	-
Sma3	Aspartate/ornithine carbamoyltransferase	IPR006130	-	-
Sma3	Epidermal growth factor-like	IPR006210	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3		IPR013091	-	-
Sma3	Rossmann-like alpha/beta/alpha sandwich fold	IPR014729	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	EGF-like calcium-binding, conserved site	IPR018097	-	-
Sma3	Ribosomal protein L19, conserved site	IPR018257	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G35380.1	Protein kinase protein with adenine nucleotide alpha hydrolases-like domain chr5:13593429-13596293 REVERSE LENGTH=731	8.0e-28	65%
RefSeq	Arabidopsis thaliana	NP_198388.1	Protein kinase protein with adenine nucleotide alpha hydrolases-like domain [Arabidopsis thaliana]	1.0e-27	65%
RefSeq	Populus trichocarpa	XP_002309024.1	predicted protein [Populus trichocarpa]	5.0e-28	67%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LPB1

Fln msg: Distance to subject end: 243 aas, your sequence is shorter than subject: 84 - 444

Fln protein: HGPVYKGSLDDTTVAIKVLATDADRNTDEFKREIEVLSCINHPNLVLLLGTCLERGCLVYEYMENGSLEDQLFHGGWKSFSSLV

Protein Length: 85

Fln nts: ACATGGTCCAGTCTACAAGGGCAGTTTGGATGATACCACTGTGGCCATCAAGGTTCTCGCTACAGATGCAGATAGAAACACAGATGAATTCAAACGGGAGATTGAGGTTCTAAGCTGCATAAATCACCCCAACTTAGTTCTGCTGCTTGGCACTTGCCTCGAACGCGGGTGTTTAGTTTATGAATATATGGAAAATGGCAGTCTAGAAGATCAGTTGTTCCACGGGGGATGGAAGAGCTTCTCTTCCTTGGTATA

Fln Alignment:

HA8LWWM01CRDIR___HGPVYKGSLDDTTVAIKVLATDADRNTDEFKREIEVLSCINHPNLVLLLGTCLERGCLVYEYMENGSLEDQL
B8LPB1________________YGIVYKGQFHVTPVAIKLLKVNWFEGSSRFQREMDRLSSIKHPRLVMLMGACPDGGFIIYEYMPRGSLEDRL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain