UniGene Name: sp_v3.0_unigene164776
Length: 233 nt
![]() |
---|
>sp_v3.0_unigene164776
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | transcription factor DcMYB3-1 [Daucus carota] | - | - | 2.0e-16 | 57% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
Sma3 | MYB transcription factor | - | - | 3.174e-11 | - |
Source | Gene names |
---|---|
Sma3 | At1g18570; At1g18570/F25I16_4; At3g01140; At4g05100; At5g07690; At5g07700; At5g14750; At5g35550; At5g40330; At5g61420; B1267B06.13; B59J16.6; DcMYB3-1; DcMYB3-2; DcMYB5; F25I16.9; FcMYB251; FcMYB303A1; FcMYB303A2; GSVIVT00002010001; GSVIVT00002213001; GSV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | transcription regulator activity | GO:0030528 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | indole glucosinolate biosynthetic process | GO:0009759 | Biological Process | 0.0 | - |
Sma3 | proanthocyanidin biosynthetic process | GO:0010023 | Biological Process | 0.0 | - |
Sma3 | trichome branching | GO:0010091 | Biological Process | 0.0 | - |
Sma3 | cellular response to sulfur starvation | GO:0010438 | Biological Process | 0.0 | - |
Sma3 | regulation of glucosinolate biosynthetic process | GO:0010439 | Biological Process | 0.0 | - |
Sma3 | cell fate commitment | GO:0045165 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | trichome patterning | GO:0048629 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | IPR014778 | - | 0.0 | - | |
Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G14750.1 | WER, ATMYB66, WER1, MYB66 myb domain protein 66 chr5:4763656-4764738 REVERSE LENGTH=203 | 9.0e-22 | 56% |
RefSeq | Arabidopsis thaliana | NP_196979.1 | transcription factor WER [Arabidopsis thaliana] | 1.0e-21 | 56% |
RefSeq | Populus trichocarpa | XP_002330768.1 | predicted protein [Populus trichocarpa] | 1.0e-22 | 57% |
![]() |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LMJ6
Fln msg: Distance to subject end: 326 aas, your sequence is shorter than subject: 71 - 392
Fln protein:
M
Protein Length:
72
Fln nts:
A
Fln Alignment:
HA8LWWM01DQ6YC___MGRSRSCFGAKSDGERLKSGAWTPSEDKILNDSIKIHGVGPWKSIAKKSGLKRCAKSCRFRWLNYLSPDIK
B8LMJ6________________MGRSPCC-----SKEGLNRGAWTKKEDMILSEYIRIHGDGGWRNLPKKAGLKRCGKSCRLRWLNYLRPDIK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain