UniGene Name: sp_v3.0_unigene164741
Length: 195 nt
UniGene Fasta |
---|
>sp_v3.0_unigene164741
C |
Ace file of the UniGene sp_v3.0_unigene164741 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative serine/threonine kinase [Platanus x acerifolia] | - | - | 9.0e-21 | 74% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
Sma3 | Chromosome undetermined scaffold_278, whole genome shotgun sequence | - | - | 1.404e-17 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.616e-12 | - |
Sma3 | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 2.659e-39 | - |
Source | Gene names |
---|---|
Sma3 | AT4g00960; AT4g27300; A_TM018A10.19; At1g11330; At1g61380; At4g00960; At4g04490; At4g04500; At4g04540; At4g11460; At4g11470; At4g11480; At4g11530; At4g21400; At4g21410; At4g23140; At4g23160; At4g23180; At4g23190; At4g23200; At4g23220; At4g23230; At4g23250 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium, incompatible interaction | GO:0009816 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G11480.1 | CRK32 cysteine-rich RLK (RECEPTOR-like protein kinase) 32 chr4:6971408-6973799 FORWARD LENGTH=656 | 2.0e-26 | 72% |
RefSeq | Arabidopsis thaliana | NP_192887.1 | putative cysteine-rich receptor-like protein kinase 32 [Arabidopsis thaliana] | 3.0e-26 | 72% |
RefSeq | Populus trichocarpa | XP_002316676.1 | predicted protein [Populus trichocarpa] | 2.0e-28 | 70% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQB9
Fln msg: Distance to subject end: 183 aas, your sequence is shorter than subject: 64 - 290
Fln protein:
N
Protein Length:
65
Fln nts:
C
Fln Alignment:
HA8LWWM01AF6WB___DPSKRNLLDWQKRYNIIMGVARGLLYLHQDSQLRIIHRDIKANNILLDKQLNPKIADFGLAK
A9NQB9________________NPERRKVLDWQKRYNIIIGVARGLLYLHQDSQLRIIHRDVKVNNILLDDKLNPKIADFGLAR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain