UniGene Name: sp_v3.0_unigene164730
Length: 178 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene164730
A |
Ace file of the UniGene sp_v3.0_unigene164730
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Reverse transcriptase (Fragment) n=2 Tax=Sciadopitys verticillata RepID=Q56GF7_SCIVE | - | - | 3.0e-20 | 80% |
| FL-Next | sp=RNA-directed DNA polymerase homolog; berteroana). Mitochondrion. | - | - | 0.0 | 58% |
| Sma3 | Reverse transcriptase | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | 17.t00023; 20.t00045; AT4g03650; AT4g04230; AT4g08100; AT4g10580; At2g04670; At2g05610; At2g06170; At2g06470; At2g06890; At2g07660; At2g14650; F23H6.1; F5K24.9; F9D12.11; F9M13.15; H0211A12.9; LOC_Os03g05350; LOC_Os03g30350; LOC_Os03g35326; LOC_Os10g06110 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | carbonate dehydratase activity | GO:0004089 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | neuropeptide signaling pathway | GO:0007218 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | carbon utilization | GO:0015976 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| RefSeq | Populus trichocarpa | XP_002314393.1 | predicted protein [Populus trichocarpa] | 3.0e-14 | 55% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P31843
Fln msg: Distance to subject end: 26 aas, your sequence is shorter than subject: 59 - 142
Fln protein:
T
Protein Length:
60
Fln nts:
A
Fln Alignment:
HA8LWWM01C6NG0___KTAFKTKQGLYEWLVMPFGLTNAPATFMRLMNDVLKPFLDDFVIVYLDDILIF
P31843________________KTTCVTRYGSFEFRVMPFGLTNALATFCNLMNNVLYEYLDHFVVVYLDDLVVY

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta