UniGene Name: sp_v3.0_unigene164724
Length: 216 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene164724
A |
Ace file of the UniGene sp_v3.0_unigene164724 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Phosphate transporter 1 n=6 Tax=Papilionoideae RepID=Q9ARI9_LUPAL | - | - | 2.0e-23 | 85% |
FL-Next | tr=Putative phosphate transporter; Cryptomeria japonica (Japanese cedar) (Cupressus japonica). | - | - | 0.0 | 75% |
Sma3 | Phosphate transporter | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | 5K14.7; APT1; APT2; At2g32830; At2g38940; At3g54700; At5g43340; At5g43350; At5g43360; At5g43370; EcPT1; EcPT2; EdPT1; F24L7.3; GSVIVT00006480001; GSVIVT00006481001; GSVIVT00020254001; GSVIVT00020255001; GSVIVT00028600001; GSVIVT00028602001; GSVIVT00029479 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | inorganic phosphate transmembrane transporter activity | GO:0005315 | Molecular Function | 0.0 | - |
Sma3 | symporter activity | GO:0015293 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | phosphate ion transport | GO:0006817 | Biological Process | 0.0 | - |
Sma3 | cellular response to phosphate starvation | GO:0016036 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | WW/Rsp5/WWP | IPR001202 | - | 0.0 | - |
Sma3 | AP2/ERF domain | IPR001471 | - | 0.0 | - |
Sma3 | Carbohydrate/puine kinase, PfkB, conserved site | IPR002173 | - | 0.0 | - |
Sma3 | Hydroxymethylglutaryl-CoA reductase, class I/II | IPR002202 | - | 0.0 | - |
Sma3 | Phosphate permease | IPR004738 | - | 0.0 | - |
Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatase | IPR006186 | - | 0.0 | - |
Sma3 | Major facilitator superfamily | IPR011701 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G38940.1 | " ATPT2, PHT1;4 phosphate transporter 1;4 chr2:16258500-16260104 FORWARD LENGTH=534" | 3.0e-28 | 75% |
RefSeq | Arabidopsis thaliana | NP_181428.1 | inorganic phosphate transporter 1-4 [Arabidopsis thaliana] | 4.0e-28 | 75% |
RefSeq | Populus trichocarpa | XP_002306623.1 | high affinity inorganic phosphate transporter [Populus trichocarpa] | 4.0e-28 | 80% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q1XG57
Fln msg: Distance to subject end: 425 aas, your sequence is shorter than subject: 71 - 544
Fln protein:
N
Protein Length:
72
Fln nts:
A
Fln Alignment:
HA8LWWM01AXQ61___HYPAGAGKVGTLPLNVSAAVNGVALCGTLAGQLFFGWLGDKLGRKKVYGLTLMIMMISAIGSGLSF
Q1XG57________________YYFEDGKKPGSLPPNVSAAVNGVALCGTLAGQLFFGWLGDKMGRKKVYGMTLMLMVICSIASGLSF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain