|
||||||
|
UniGene Name: sp_v3.0_unigene164693
Length: 241 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene164693
A |
|
Ace file of the UniGene sp_v3.0_unigene164693 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative GTP-binding protein [Gossypium hirsutum] | - | - | 6.0e-17 | 92% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
| Sma3 | Ras-related protein Rab11A | - | - | 5.723e-15 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sphingomyelin phosphodiesterase. | EC:3.1.4.12 | - | 1.676e-21 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sphingolipid metabolism | 00600 | 1.676e-21 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.676e-21 | % |
| Source | Gene names |
|---|---|
| Sma3 | 24.t00014; 25.t00015; 26.t00023; 80A08_30; ARA; ARA-1; ARA-2; ARA-4; AT1G06400; AT2G43130; AT4g18430; AT4g18800; AT4g39990; At1g01200; At1g05810; At1g06400; At1g09630; At1g16920; At1g18200; At1g28550; At1g73640; At2g31680; At2g33870; At2g43130; At3g07410; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | endosome | GO:0005768 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | Golgi stack | GO:0005795 | Cellular Component | 0.0 | - |
| Sma3 | Golgi-associated vesicle | GO:0005798 | Cellular Component | 0.0 | - |
| Sma3 | trans-Golgi network | GO:0005802 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | cell plate | GO:0009504 | Cellular Component | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | small GTPase mediated signal transduction | GO:0007264 | Biological Process | 0.0 | - |
| Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
| Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | inter-Golgi cisterna vesicle-mediated transport | GO:0048219 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Mannose-binding lectin | IPR001229 | - | 0.0 | - |
| Sma3 | Small GTPase superfamily | IPR001806 | - | 0.0 | - |
| Sma3 | RNA polymerase sigma factor 54, interaction | IPR002078 | - | 0.0 | - |
| Sma3 | Small GTPase superfamily, Rab type | IPR003579 | - | 0.0 | - |
| Sma3 | Small GTP-binding protein domain | IPR005225 | - | 0.0 | - |
| Sma3 | GCK | IPR012891 | - | 0.0 | - |
| Sma3 | IPR013753 | - | 0.0 | - | |
| Sma3 | IPR015595 | - | 0.0 | - | |
| Sma3 | DNA-directed DNA polymerase, family A, conserved site | IPR019760 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G45750.1 | AtRABA1c, RABA1c RAB GTPase homolog A1C chr5:18559318-18560639 FORWARD LENGTH=216 | 1.0e-21 | 88% |
| RefSeq | Arabidopsis thaliana | NP_199387.1 | Ras-related protein RABA1c [Arabidopsis thaliana] | 2.0e-21 | 88% |
| RefSeq | Populus trichocarpa | XP_002334115.1 | predicted protein, partial [Populus trichocarpa] | 8.0e-25 | 92% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NV29
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 113 aas, your sequence is shorter than subject: 79 - 216
Fln protein:
K
Protein Length:
80
Fln nts:
A
Fln Alignment:
HA8LWWM01BCRK6___KSNLLSRFTRNEFLVLESKSTIGVEFATRSINVDGKMIKAQIWDTAGQER
A9NV29________________KSNLLSRFTRNEFS-LESKSTIGVEFATRSINVDGKMIKAQIWDTAGQER
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
