UniGene Name: sp_v3.0_unigene164692
Length: 133 nt
![]() |
---|
>sp_v3.0_unigene164692
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | transcription factor MYB4 [Brassica rapa var. purpuraria] | - | - | 7.0e-16 | 90% |
FL-Next | tr=R2R3-MYB transcription factor MYB5; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 85% |
Sma3 | R2r3-myb transcription factor, putative | - | - | 1.395e-15 | - |
Source | Gene names |
---|---|
Sma3 | At1g22640; At1g35515; At2g16720; At4g09460; At4g34990; At4g38620; F12K8.1; F20M13.180; GSVIVT00017797001; GSVIVT00017798001; GSVIVT00022367001; GSVIVT00032264001; GSVIVT00033103001; GSVIVT00036110001; GSVIVT00036753001; GSVIVT00038661001; GSVIVT0003866200 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
Sma3 | cold acclimation | GO:0009631 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | cinnamic acid biosynthetic process | GO:0009800 | Biological Process | 0.0 | - |
Sma3 | negative regulation of metabolic process | GO:0009892 | Biological Process | 0.0 | - |
Sma3 | response to UV-B | GO:0010224 | Biological Process | 0.0 | - |
Sma3 | GO:0016481 | Biological Process | 0.0 | - | |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
Sma3 | Transposon, En/Spm-like | IPR004242 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | IPR014778 | - | 0.0 | - | |
Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G38620.1 | ATMYB4, MYB4 myb domain protein 4 chr4:18053866-18054876 FORWARD LENGTH=282 | 5.0e-22 | 87% |
RefSeq | Arabidopsis thaliana | NP_195574.1 | transcription repressor MYB4 [Arabidopsis thaliana] | 7.0e-22 | 87% |
RefSeq | Populus trichocarpa | XP_002312966.1 | predicted protein [Populus trichocarpa] | 2.0e-21 | 85% |
![]() |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A5JYE9
Fln msg: Distance to subject end: 217 aas, your sequence is shorter than subject: 40 - 257
Fln protein:
M
Protein Length:
41
Fln nts:
A
Fln Alignment:
HA8LWWM01DXE15___MGRSPCCEKAHTNKGAWSKDEDEILIAYIQAHGEGCWRSL
A5JYE9________________MGRSPCCEKAHTNKGAWTKEEDDRLIAHIRAHGEGCWRSL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain