|
||||||
|
UniGene Name: sp_v3.0_unigene164641
Length: 207 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene164641
T |
|
Ace file of the UniGene sp_v3.0_unigene164641
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | OSIGBa0111L12.7 protein n=1 Tax=Oryza sativa RepID=Q01IZ5_ORYSA | - | - | 5.0e-16 | 60% |
| FL-Next | tr=OSIGBa0111L12.7 protein; Oryza sativa (Rice). | - | - | 0.0 | 60% |
| Sma3 | Polyprotein | - | - | 8.129e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | LOC_Os10g40400; LOC_Os10g40890; LOC_Os11g08610; LOC_Os12g18080; OSIGBa0111L12.7; OSJNBa0010C11.17; Os07g0195900; Os07g0528900; Os09g0135100; Os09g0321300; VITISV_003711; VITISV_011228; VITISV_013478; VITISV_018166; VITISV_020633; VITISV_023158; VITISV_025 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | SNAP receptor activity | GO:0005484 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | intracellular protein transport | GO:0006886 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | vesicle-mediated transport | GO:0016192 | Biological Process | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: Q01IZ5
Fln msg: Distance to subject end: 79 aas, your sequence is shorter than subject: 69 - 940
Fln protein:
W
Protein Length:
70
Fln nts:
T
Fln Alignment:
HA8LWWM01BH2ZM___WKEISMDFIEGLPMSNEKDKILVVVDSPTKYAHFMGMKKLDSAKEIAEIFCKNVYKLHGFPKFIISNRD
Q01IZ5________________WQIISMDFIEGLPRSNKQDCILVVVDKFSKYAHFMTLSHPFSAMDVAKVFMLNVYELHGLPQAIISDRD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
