|
||||||
|
UniGene Name: sp_v3.0_unigene164598
Length: 209 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene164598
T |
|
Ace file of the UniGene sp_v3.0_unigene164598 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | protein kinase [Nicotiana tabacum] | - | - | 7.0e-16 | 88% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
| Sma3 | Mitogen activated protein kinase kinase kinase 3, mapkkk3, mekk3, putative | - | - | 5.432e-07 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 8.814e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | ANP1; ANP2; ANP3; At1g09000; At1g54960; At1g63700; At3g06030; B0103C08-B0602B01.10; CHLREDRAFT_105035; CHLREDRAFT_121660; CHLREDRAFT_98709; DUPR11.32; F14C21.49; F24F17.1; F2O10.1; F7G19.13; GSVIVT00019932001; GSVIVT00022837001; GSVIVT00034808001; GSVIVT0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | MAP kinase kinase kinase activity | GO:0004709 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | cytokinesis | GO:0000910 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | DNA repair metallo-beta-lactamase | IPR011084 | - | 0.0 | - |
| Sma3 | IPR015748 | - | 0.0 | - | |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Transcription regulator, HTH DeoR-type, conserved site | IPR018356 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G06030.1 | ANP3, MAPKKK12, NP3 NPK1-related protein kinase 3 chr3:1818895-1822705 REVERSE LENGTH=651 | 1.0e-19 | 85% |
| RefSeq | Arabidopsis thaliana | NP_187254.1 | mitogen-activated protein kinase kinase kinase 3 [Arabidopsis thaliana] | 2.0e-19 | 85% |
| RefSeq | Populus trichocarpa | XP_002311605.1 | predicted protein, partial [Populus trichocarpa] | 8.0e-21 | 90% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LR19
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 237 aas, your sequence is shorter than subject: 44 - 902
Fln protein:
W
Protein Length:
45
Fln nts:
T
Fln Alignment:
HA8LWWM01BGCBG___WMAPEVIRQ--TGHSLPADIWSVGCTVIEMATGKPPWSQ
B8LR19________________WMAPEVLMQKNTGHDLAVDIWSLGCTVIEMATGKPPWSE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
