UniGene Name: sp_v3.0_unigene164573
Length: 136 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene164573
C |
Ace file of the UniGene sp_v3.0_unigene164573
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative flavin-containing monooxygenase [Oryza sativa Japonica Group] | - | - | 1.0e-13 | 72% |
| FL-Next | sp=Flavin-containing monooxygenase FMO GS-OX-like 2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 72% |
| Sma3 | Dimethylaniline monooxygenase, putative | - | - | 6.576e-10 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavin-containing monooxygenase. | EC:1.14.13.8 | - | 2.401e-09 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Methane metabolism | 00680 | 2.401e-09 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 2.401e-09 | % |
| Source | Gene names |
|---|---|
| Sma3 | AP5_G04.1; At1g12140; At1g12200; At1g62600; At1g63340; CHLREDRAFT_206139; F9N12.1; F9N12.4; FMO1; FMOGS-OX5; GSVIVT00007303001; GSVIVT00007305001; GSVIVT00007306001; GSVIVT00016274001; LOC_Os10g40570; MICPUCDRAFT_60580; MICPUN_97495; OJ1118_G09.101; OJ111 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | microsome | GO:0005792 | Cellular Component | 0.0 | - |
| Sma3 | intrinsic to endoplasmic reticulum membrane | GO:0031227 | Cellular Component | 0.0 | - |
| Sma3 | N,N-dimethylaniline monooxygenase activity | GO:0004499 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | NADP binding | GO:0050661 | Molecular Function | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class-II | IPR000103 | - | 0.0 | - |
| Sma3 | Flavin monooxygenase FMO | IPR000960 | - | 0.0 | - |
| Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
| Sma3 | Metallophosphoesterase domain | IPR004843 | - | 0.0 | - |
| Sma3 | Dimethylaniline monooxygenase, N-oxide-forming | IPR012143 | - | 0.0 | - |
| Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
| Sma3 | Purple acid phosphatase, N-terminal | IPR015914 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G12200.1 | Flavin-binding monooxygenase family protein chr1:4137627-4139835 FORWARD LENGTH=465 | 3.0e-18 | 72% |
| RefSeq | Arabidopsis thaliana | NP_172684.1 | dimethylaniline monooxygenase (N-oxide forming) [Arabidopsis thaliana] | 3.0e-18 | 72% |
| RefSeq | Populus trichocarpa | XP_002329910.1 | predicted protein [Populus trichocarpa] | 8.0e-17 | 73% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9FWW9
Fln msg: Distance to subject end: 118 aas, your sequence is shorter than subject: 45 - 465
Fln protein:
I
Protein Length:
46
Fln nts:
C
Fln Alignment:
HA8LWWM01B1JOF___VSVNDNCVGPLYQHVFPPVLAPSLSFVGLPWKVVPFPLCELQSR
Q9FWW9________________VTVDDNRVGPLYKHVFPPALAPSLSFIGLPWQITPFPMFELQSK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta