|
||||||
|
UniGene Name: sp_v3.0_unigene164475
Length: 175 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene164475
C |
|
Ace file of the UniGene sp_v3.0_unigene164475
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Copia-type polyprotein, putative n=1 Tax=Arabidopsis thaliana RepID=Q9C536_ARATH | - | - | 1.0e-13 | 64% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 55% |
| Sma3 | Retrotransposon protein, putative, unclassified | - | - | 5.79e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g05390; F11I4_21; LOC_Os03g59190; LOC_Os03g61660; LOC_Os10g01750; LOC_Os11g29950; LOC_Os11g35630; LOC_Os11g36110; LOC_Os11g44780; LOC_Os12g05290; LOC_Os12g05520; LOC_Os12g44200; OSIGBa0134J07.9; OSIGBa0153E02-OSIGBa0093I20.3; OSJNBa0012L23.58; OSJNBa00 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | oxygen evolving complex | GO:0009654 | Cellular Component | 0.0 | - |
| Sma3 | extrinsic to membrane | GO:0019898 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
| Sma3 | phosphotransferase activity, alcohol group as acceptor | GO:0016773 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | photosynthesis | GO:0015979 | Biological Process | 0.0 | - |
| Sma3 | phosphorylation | GO:0016310 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G23160.1 | CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 chr4:12129485-12134086 FORWARD LENGTH=1262 | 1.0e-15 | 56% |
| RefSeq | Arabidopsis thaliana | NP_194047.2 | cysteine-rich receptor-like protein kinase 8 [Arabidopsis thaliana] | 1.0e-15 | 56% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 268 aas, your sequence is shorter than subject: 58 - 363
Fln protein:
L
Protein Length:
59
Fln nts:
C
Fln Alignment:
HA8LWWM01DDZ8N___GSVDKYKARLVAKGYS*KEGIDYDETFALVVKLNTIRLIIALTTKYNWKLHQLDVK
B8LKV8________________GELDKHKARLVAKGFAQEYGVDYNETFAPVARLDTIRMVLAIAAQHNWKVYQMDVK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
