UniGene Name: sp_v3.0_unigene164406
Length: 215 nt
UniGene Fasta |
---|
>sp_v3.0_unigene164406
C |
Ace file of the UniGene sp_v3.0_unigene164406 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=Phosphoribosylamine--glycine ligase; AltName: Full=Glycinamide ribonucleotide synthetase; Short=GARS; AltName: Full=Phosphoribosylglycinamide synthetase gb|AAA74447.1| glycinamide ribonucleotide (GAR) synthetase [Vigna unguiculata] | - | - | 2.0e-21 | 85% |
FL-Next | sp=Phosphoribosylamine--glycine ligase, chloroplastic; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 85% |
Sma3 | Glycinamide ribonucleotide synthetase | - | - | 1.284e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphoribosylamine--glycine ligase. | EC:6.3.4.13 | - | 8.892e-20 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Purine metabolism | 00230 | 8.892e-20 | % | |
Sma3 | Metabolic pathways | 01100 | 8.892e-20 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 8.892e-20 | % |
Source | Gene names |
---|---|
Sma3 | At1g09830; CHLREDRAFT_175039; F21M12.22; GSVIVT00000242001; GSVIVT00000244001; LOC_Os12g09540; MICPUCDRAFT_20099; MICPUN_106946; OSJNBa0056O06.1; OSTLU_39441; Os08g0191200; Os12g0197100; OsI_28100; OsI_37769; OsJ_26312; OsJ_35522; Ot12g01360; P0610E02.33; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | phosphoribosylamine-glycine ligase activity | GO:0004637 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | purine nucleotide biosynthetic process | GO:0006164 | Biological Process | 0.0 | - |
Sma3 | purine base biosynthetic process | GO:0009113 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphoribosylglycinamide synthetase | IPR000115 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | ATP-grasp fold | IPR011761 | - | 0.0 | - |
Sma3 | ATP-grasp fold, subdomain 1 | IPR013815 | - | 0.0 | - |
Sma3 | ATP-grasp fold, subdomain 2 | IPR013816 | - | 0.0 | - |
Sma3 | IPR013817 | - | 0.0 | - | |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G09830.1 | Glycinamide ribonucleotide (GAR) synthetase chr1:3192783-3194936 REVERSE LENGTH=532 | 2.0e-23 | 85% |
RefSeq | Arabidopsis thaliana | NP_172454.1 | phosphoribosylamine--glycine ligase [Arabidopsis thaliana] | 3.0e-23 | 85% |
RefSeq | Populus trichocarpa | XP_002328784.1 | predicted protein [Populus trichocarpa] | 5.0e-23 | 82% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P52420
Fln msg: Separated hits, possible frame ERROR between 125 and 137, Distance to subject end: 187 aas, your sequence is shorter than subject: 71 - 532
Fln protein:
A
Protein Length:
72
Fln nts:
C
Fln Alignment:
HA8LWWM01C02J7___AGHQIIVEEFLEGEEASFFALVDGENALPLASAQDHKRVGExxxxPNTGGMGAYSPAPILTKELESVVMKS
P52420________________AGCQVVVEEFLEGEEASFFALVDGENAIPLESAQDHKRVGDxxxxPNTGGMGAYSPAPVLTKELQDFVMES
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain