UniGene Name: sp_v3.0_unigene164397
Length: 238 nt
UniGene Fasta |
---|
>sp_v3.0_unigene164397
C |
Ace file of the UniGene sp_v3.0_unigene164397 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=Alpha-glucan water dikinase, chloroplastic; AltName: Full=Starch-related R1 protein; Flags: Precursor emb|CAA70725.1| R1 [Solanum tuberosum] | - | - | 1.0e-27 | 88% |
FL-Next | sp=Alpha-glucan water dikinase, chloroplastic; Solanum tuberosum (Potato). | - | - | 0.0 | 88% |
Sma3 | Glucan water dikinase | - | - | 6.584e-09 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Histidine kinase. | EC:2.7.13.3 | - | 9.75e-06 | - |
Sma3 | Alpha-glucan, water dikinase. | EC:2.7.9.4 | - | 2.229e-23 | - |
Source | Gene names |
---|---|
Sma3 | At1g10760; At4g24450; GSVIVT00002767001; GWD; GWD1; GWD2; MICPUN_57949; OSTLU_50201; Os06g0498400; OsI_23085; OsJ_21446; PHYPADRAFT_129189; PHYPADRAFT_174645; POPTRDRAFT_1089922; R1; R1-1; RCOM_0024100; RCOM_0482810; SEX1; T16B5.10; T22A6.280; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | enzyme inhibitor activity | GO:0004857 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
Sma3 | pectinesterase activity | GO:0030599 | Molecular Function | 0.0 | - |
Sma3 | alpha-glucan, water dikinase activity | GO:0050521 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | phosphorylation | GO:0016310 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | PEP-utilising enzyme, C-terminal | IPR000121 | - | 0.0 | - |
Sma3 | Pyruvate phosphate dikinase, PEP/pyruvate-binding | IPR002192 | - | 0.0 | - |
Sma3 | Pectinesterase inhibitor | IPR006501 | - | 0.0 | - |
Sma3 | ATP-grasp fold, subdomain 1 | IPR013815 | - | 0.0 | - |
Sma3 | ATP-grasp fold, subdomain 2 | IPR013816 | - | 0.0 | - |
Sma3 | PEP-utilising enzyme, active site | IPR018274 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G10760.1 | SEX1, SOP1, SOP, GWD1, GWD Pyruvate phosphate dikinase, PEP/pyruvate binding domain chr1:3581210-3590043 REVERSE LENGTH=1399 | 9.0e-30 | 84% |
RefSeq | Arabidopsis thaliana | NP_563877.1 | alpha-glucan water dikinase 1 [Arabidopsis thaliana] | 1.0e-29 | 84% |
RefSeq | Populus trichocarpa | XP_002315679.1 | predicted protein [Populus trichocarpa] | 1.0e-30 | 88% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9AWA5
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 133 aas, your sequence is shorter than subject: 61 - 1464
Fln protein:
G
Protein Length:
62
Fln nts:
C
Fln Alignment:
HA8LWWM01BF250___GDEGEKRWQQAWMAIKKVWASKWNERAYFSARKVKVEHNDLCMAVLVQEIINADYAFVI
Q9AWA5________________GDEGPKRWEQAWMAIKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain