|
||||||
|
UniGene Name: sp_v3.0_unigene164389
Length: 217 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene164389
T |
|
Ace file of the UniGene sp_v3.0_unigene164389
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | rve domain containing protein | - | - | 2.0e-10 | 45% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 61% |
| Sma3 | Retrotransposon protein, putative, unclassified | - | - | 4.806e-20 | - |
| Source | Gene names |
|---|---|
| Sma3 | 117M18_33; AT4g04380; At2g05960; At2g11230; At2g15650; At2g17490; B1110B01.4; F11I4_21; F28G4.2; F28H19.6; H0512B01.8; LOC_Os03g01684; LOC_Os03g05850; LOC_Os03g13260; LOC_Os03g26290; LOC_Os03g26570; LOC_Os03g28110; LOC_Os03g47410; LOC_Os03g56530; LOC_Os03 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | potassium ion transmembrane transporter activity | GO:0015079 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
| Sma3 | tRNA dihydrouridine synthase activity | GO:0017150 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | rRNA N-glycosylase activity | GO:0030598 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | potassium ion transport | GO:0006813 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | tRNA processing | GO:0008033 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of translation | GO:0017148 | Biological Process | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKX7
Fln msg: Distance to subject end: 126 aas, your sequence is shorter than subject: 72 - 407
Fln protein:
S
Protein Length:
73
Fln nts:
T
Fln Alignment:
HA8LWWM01EUC0E___FSNFCDTHGIKRQLTTPYTPQQNSVVERRNRTVVEMARSMLQHRSVPNKFWAEAIFTAVYLLNRSPT
B8LKX7________________FDHYCKYNGIKREHTVPYTPQQNGVAERKNRTLMEMARCMLHARNMDPKFWAEAINTATYIVNRTPT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
