UniGene Name: sp_v3.0_unigene164208
Length: 202 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene164208
C |
Ace file of the UniGene sp_v3.0_unigene164208
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Alcohol dehydrogenase (Fragment) n=2 Tax=Pinus banksiana RepID=Q43024_PINBN | - | - | 2.0e-32 | 98% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
| Sma3 | Alcohol dehydrogenase | - | - | 5.907e-17 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alcohol dehydrogenase. | EC:1.1.1.1 | - | 2.331e-24 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 2.331e-24 | % | |
| Sma3 | Fatty acid metabolism | 00071 | 2.331e-24 | % | |
| Sma3 | Glycine, serine and threonine metabolism | 00260 | 2.331e-24 | % | |
| Sma3 | Tyrosine metabolism | 00350 | 2.331e-24 | % | |
| Sma3 | Chloroalkane and chloroalkene degradation | 00625 | 2.331e-24 | % | |
| Sma3 | Naphthalene degradation | 00626 | 2.331e-24 | % | |
| Sma3 | Retinol metabolism | 00830 | 2.331e-24 | % | |
| Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 2.331e-24 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 2.331e-24 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.331e-24 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.331e-24 | % | |
| Sma3 | S-(hydroxymethyl)glutathione dehydrogenase. | EC:1.1.1.284 | - | 2.502e-06 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Methane metabolism | 00680 | 2.502e-06 | % |
| Source | Gene names |
|---|---|
| Sma3 | ADH1; ADH2; ADH6; Adh; Adh1; Adh1A; Adh1B; Adh2; Adh5; AdhC2; AdhC6; AdhC7; AdhD; AdhE; GSVIVT00034830001; GSVIVT00034832001; GSVIVT00034834001; OG_ABa077F15_032P05-5; OP_Ba004F03-2; OR_BBa102H20-2; RCOM_0138590; RCOM_0236080; VITISV_006227; VITISV_039578 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | alcohol dehydrogenase (NAD) activity | GO:0004022 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor | GO:0016616 | Molecular Function | 0.0 | - |
| Sma3 | cofactor binding | GO:0048037 | Molecular Function | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
| Sma3 | Alcohol dehydrogenase, zinc-type, conserved site | IPR002328 | - | 0.0 | - |
| Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
| Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G77120.1 | ADH1, ADH, ATADH, ATADH1 alcohol dehydrogenase 1 chr1:28975509-28977216 FORWARD LENGTH=379 | 5.0e-34 | 83% |
| RefSeq | Arabidopsis thaliana | NP_177837.1 | alcohol dehydrogenase class-P [Arabidopsis thaliana] | 7.0e-34 | 83% |
| RefSeq | Populus trichocarpa | XP_002309900.1 | predicted protein [Populus trichocarpa] | 1.0e-34 | 82% |
Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5ADY4
Fln msg: Distance to subject end: 201 aas, atg_distance in limit (1-15): atg_distance = 1, your sequence is shorter than subject: 67 - 268
Fln protein:
M
Protein Length:
68
Fln nts:
C
Fln Alignment:
HA8LWWM01CX7FU___MCDLLRIDTERGVMISDGNSRFSINGKPIHHFLGTSTFSEYTVAHAGCVAKINPKAPLDKVCVLSCG
D5ADY4________________MCDLLRINTERGVMISDGKSRFSINGKPIYHFLGTSTFSEYTVAHVGCVAKINPEAPLNKVCVLSCG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta