UniGene Name: sp_v3.0_unigene164202
Length: 225 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene164202
C |
Ace file of the UniGene sp_v3.0_unigene164202
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Probable glutathione S-transferase n=1 Tax=Picea mariana RepID=O65056_PICMA | - | - | 8.0e-27 | 83% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 87% |
| Sma3 | Glutathione S-transferase GSTU6 | - | - | 2.10195e-44 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutathione transferase. | EC:2.5.1.18 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutathione metabolism | 00480 | 0.0 | % | |
| Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 0.0 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 0.0 | % | |
| Sma3 | Lactoylglutathione lyase. | EC:4.4.1.5 | - | 6.96e-22 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyruvate metabolism | 00620 | 6.96e-22 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g59670; At1g59700; At1g78340; At1g78340/F3F9_13; At1g78370; At2g29420; At3g09270; BI-GST/GPX; C-7; EgHypar; F23H11.1; F3L24.14; GST; GST1; GST1a; GST1b; GST2; GST25; GST5; GSTU1; GSTU2; GSTa; GSVIVT00000139001; GSVIVT00000140001; GSVIVT00000141001; GSV |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | glutathione transferase activity | GO:0004364 | Molecular Function | 0.0 | - |
| Sma3 | lactoylglutathione lyase activity | GO:0004462 | Molecular Function | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | toxin catabolic process | GO:0009407 | Biological Process | 0.0 | - |
| Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
| Sma3 | Glutathione S-transferase, N-terminal | IPR004045 | - | 0.0 | - |
| Sma3 | Glutathione S-transferase, C-terminal | IPR004046 | - | 0.0 | - |
| Sma3 | Glutathione S-transferase, C-terminal-like | IPR010987 | - | 0.0 | - |
| Sma3 | IPR012335 | - | 0.0 | - | |
| Sma3 | Glutathione S-transferase/chloride channel, C-terminal | IPR017933 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G59700.1 | ATGSTU16, GSTU16 glutathione S-transferase TAU 16 chr1:21936459-21937763 FORWARD LENGTH=234 | 9.0e-27 | 54% |
| RefSeq | Arabidopsis thaliana | NP_176178.1 | glutathione S-transferase TAU 16 [Arabidopsis thaliana] | 1.0e-26 | 54% |
| RefSeq | Populus trichocarpa | XP_002300485.1 | predicted protein [Populus trichocarpa] | 3.0e-29 | 68% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P2I2
Fln msg: Distance to subject end: 148 aas, your sequence is shorter than subject: 74 - 239
Fln protein:
Y
Protein Length:
75
Fln nts:
C
Fln Alignment:
HA8LWWM01EGVAQ___SPFVVRIRIALALKGIHYEFIEEDIHNNKSQLILSSNPVHKKIPVLIHNGKPVCESMIIVQYIEEAWDTKAP
A9P2I2________________SPFVLRVRIALALKGIHYEFIEENLLN-KSQLLLQSNPVHKKIPVLIHNGKPVCESMIIVQYIEEAWDSKAP

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta