|
||||||
|
UniGene Name: sp_v3.0_unigene164146
Length: 95 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene164146
T |
|
Ace file of the UniGene sp_v3.0_unigene164146
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Heme oxygenase n=1 Tax=Adiantum capillus-veneris RepID=Q0WYD5_ADICA | - | - | 4.0e-10 | 90% |
| FL-Next | tr=Heme oxygenase 1; Pinus taeda (Loblolly pine). | - | - | 0.0 | 80% |
| Sma3 | Heme oxygenase 1 | - | - | 8.884e-20 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g58300; At1g69720; At2g26670; F19C14.8; GSVIVT00016897001; HO1; HO3; HO4; HY1; POPTRDRAFT_779760; POPTRDRAFT_819093; RCOM_0223730; T6C23.8; VITISV_031863; ho1; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | heme oxygenase (decyclizing) activity | GO:0004392 | Molecular Function | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | heme oxidation | GO:0006788 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | chloroplast-nucleus signaling pathway | GO:0010019 | Biological Process | 0.0 | - |
| Sma3 | phytochromobilin biosynthetic process | GO:0010024 | Biological Process | 0.0 | - |
| Sma3 | regulation of meristem growth | GO:0010075 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
| Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
| Sma3 | Haem oxygenase | IPR002051 | - | 0.0 | - |
| Sma3 | Haem oxygenase-like | IPR016053 | - | 0.0 | - |
| Sma3 | Haem oxygenase-like, multi-helical | IPR016084 | - | 0.0 | - |
| Sma3 | Haem oxygenase (decyclizing), plant | IPR016951 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G26670.1 | HY1, ATHO1, HO1, TED4, GUN2, HY6 Plant haem oxygenase (decyclizing) family protein chr2:11341816-11343394 FORWARD LENGTH=282 | 4.0e-14 | 87% |
| RefSeq | Arabidopsis thaliana | NP_001118392.1 | heme oxygenase 1 [Arabidopsis thaliana] | 3.0e-14 | 87% |
| RefSeq | Populus trichocarpa | XP_002324655.1 | predicted protein [Populus trichocarpa] | 2.0e-14 | 87% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q94FW5
Fln msg: Distance to subject end: 64 aas, your sequence is shorter than subject: 31 - 316
Fln protein:
A
Protein Length:
32
Fln nts:
T
Fln Alignment:
HA8LWWM01DN7IF___AEKDPPAFICHFYNIYFAHNAGGQMIGRQVA
Q94FW5________________SEKDPPAFLCHFYNVYFAHTAGGRMIGRKVA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
