UniGene Name: sp_v3.0_unigene164034
Length: 161 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene164034
A |
Ace file of the UniGene sp_v3.0_unigene164034
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DUF659 domain containing protein | - | - | 9.0e-20 | 69% |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 67% |
| Sma3 | Chromosome chr9 scaffold_90, whole genome shotgun sequence | - | - | 6.292e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | GSVIVT00000858001; GSVIVT00001531001; GSVIVT00002235001; GSVIVT00014165001; GSVIVT00022661001; GSVIVT00024230001; GSVIVT00025712001; GSVIVT00029236001; GSVIVT00031266001; GSVIVT00037518001; GSVIVT00037637001; GSVIVT00037638001; VITISV_000096; VITISV_00365 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | DNA-directed RNA polymerase activity | GO:0003899 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | GO:0006350 | Biological Process | 0.0 | - | |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycoside hydrolase, family 1 | IPR001360 | - | 0.0 | - |
| Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, BED-type predicted | IPR003656 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb1, domain 5 | IPR007081 | - | 0.0 | - |
| Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
| Sma3 | HAT dimerisation | IPR008906 | - | 0.0 | - |
| Sma3 | IPR011523 | - | 0.0 | - | |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
| Sma3 | DNA-directed RNA pol I, largest subunit | IPR015699 | - | 0.0 | - |
| Sma3 | IPR015706 | - | 0.0 | - | |
| Sma3 | Zinc finger, C2H2-like | IPR015880 | - | 0.0 | - |
| Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
| Sma3 | MULE transposase domain | IPR018289 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5ART0
Fln msg: Distance to subject end: 101 aas, your sequence is shorter than subject: 53 - 378
Fln protein:
N
Protein Length:
54
Fln nts:
A
Fln Alignment:
HA8LWWM01EOY0A___NFLIFCPQGTMFLKSIDASYTVKDGELLFQLLDXXXXXXXXXXXXQIITDSAS
A5ART0________________NFLVNSPTGTWFMKSIDASDTIKNGELMFKYLDEVVEEIGEENVVQVITDNAS

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta