|
||||||
|
UniGene Name: sp_v3.0_unigene163640
Length: 208 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene163640
A |
|
Ace file of the UniGene sp_v3.0_unigene163640 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative polyprotein n=1 Tax=Oryza sativa Japonica Group RepID=Q6AUP9_ORYSJ | - | - | 8.0e-16 | 61% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 51% |
| Sma3 | Putative gag-pol polyprotein | - | - | 4.733e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | F11I4_21; LOC_Os03g26290; LOC_Os03g47702; LOC_Os03g61660; LOC_Os10g01750; LOC_Os10g12760; LOC_Os10g17570; LOC_Os11g09330; LOC_Os12g01790; LOC_Os12g05520; LOC_Os12g09260; LOC_Os12g40060; LOC_Os12g44200; OJ000114_01.9; OJ1006F06.13; OSIGBa0134J07.9; OSJNBa0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | GPI anchor biosynthetic process | GO:0006506 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKX7
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 96 aas, your sequence is shorter than subject: 69 - 407
Fln protein:
E
Protein Length:
70
Fln nts:
A
Fln Alignment:
HA8LWWM01BTT82___LKSARSMLQGKNISNVFWAEAINTAVYLKNRSPTKSLELKTPFEAFYGYKPKVSHLRVFGCKAFAH
B8LKX7________________MEMARCMLHARNMDPKFWAEAINTATYIVNRTPTIAVKHKTPEEAWSRRKPTVSHFKVFGCDVYVH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
