UniGene Name: sp_v3.0_unigene163422
Length: 197 nt
UniGene Fasta |
---|
>sp_v3.0_unigene163422
A |
Ace file of the UniGene sp_v3.0_unigene163422 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 79% |
Sma3 | Pentatricopeptide, putative, expressed | - | - | 1.353e-06 | - |
Source | Gene names |
---|---|
Sma3 | At2g29760; At3g24000; At4g16835; At5g37570; At5g39350; DYW10; F14O13.19; FCAALL.441; GSVIVT00000282001; GSVIVT00000887001; GSVIVT00001706001; GSVIVT00002188001; GSVIVT00003648001; GSVIVT00006973001; GSVIVT00008660001; GSVIVT00010312001; GSVIVT00011842001; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, acting on ester bonds | GO:0016788 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G18750.1 | DOT4 Pentatricopeptide repeat (PPR) superfamily protein chr4:10304850-10307465 FORWARD LENGTH=871 | 1.0e-21 | 55% |
RefSeq | Arabidopsis thaliana | NP_193610.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-21 | 55% |
RefSeq | Populus trichocarpa | XP_002300569.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-23 | 61% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Distance to subject end: 149 aas, your sequence is shorter than subject: 65 - 312
Fln protein:
F
Protein Length:
66
Fln nts:
A
Fln Alignment:
HA8LWWM01C3T1E___FIDRMPFEPSASVWGALLGACRIHHNIELGEHVAEHLLKLDPQNAGYYVLMSNIYAAGGRWDDV
D5ADG9________________FIEKMPIEPGASVWGAFLGSCRIHCNIELGERVAELLLNLDPDNAGYYVLLSNIYAAAGRWDDV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain