UniGene Name: sp_v3.0_unigene163412
Length: 200 nt
UniGene Fasta |
---|
>sp_v3.0_unigene163412
A |
Ace file of the UniGene sp_v3.0_unigene163412 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pol protein integrase region (Fragment) n=6 Tax=Spermatophyta RepID=Q9M6N3_9CONI | - | - | 2.0e-17 | 91% |
FL-Next | tr=Putative retroelement protein; Sorghum bicolor (Sorghum) (Sorghum vulgare). | - | - | 0.0 | 60% |
Sma3 | Pol protein integrase region | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | At2g05610; H0321H01.8; LOC_Os03g47840; LOC_Os03g61190; LOC_Os10g09950; LOC_Os10g28310; LOC_Os10g40890; LOC_Os11g45000; LOC_Os12g17360; LOC_Os12g24050; MtrDRAFT_AC157777g26v2; OJ1111_B11.1; OSJNBa0004B23.3; OSJNBa0010C11.17; OSJNBa0010E04.6; OSJNBa0013D02. |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Ribosomal protein S15 | IPR000589 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | FAR1 DNA binding domain | IPR004330 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
Sma3 | S15/NS1, RNA-binding | IPR009068 | - | 0.0 | - |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: B3VTB8
Fln msg: Distance to subject end: 266 aas, your sequence is shorter than subject: 66 - 732
Fln protein:
I
Protein Length:
67
Fln nts:
A
Fln Alignment:
HA8LWWM01C2OIY___KIPDLLQPLSIPSQHWEEVSMDFITSLHKSEGKSVIMVVVDRLTKYAHFCALSHPFKASTVSTAF
B3VTB8________________QLAGLLQPLDVPSQVWADISMDFIDALPKVHGKSVILTVVDRFSKYAHFIALSHPYTAASVARAF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain