|
||||||
|
UniGene Name: sp_v3.0_unigene163376
Length: 177 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene163376
C |
|
Ace file of the UniGene sp_v3.0_unigene163376
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RVT_1 domain containing protein | - | - | 0.0001 | 19% |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 61% |
| Source | Gene names |
|---|---|
| Sma3 | AT4g07600; GSVIVT00005459001; GSVIVT00005481001; GSVIVT00005553001; GSVIVT00008081001; GSVIVT00009118001; RT; T14A16.2; VITISV_000019; VITISV_000545; VITISV_000916; VITISV_001231; VITISV_002055; VITISV_002499; VITISV_002952; VITISV_003071; VITISV_003211; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | KID repeat | IPR003900 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Nitrite/sulphite reductase iron-sulphur/siroheam-binding site | IPR006066 | - | 0.0 | - |
| Sma3 | Zinc finger, PMZ-type | IPR006564 | - | 0.0 | - |
| Sma3 | Fatty acid hydroxylase | IPR006694 | - | 0.0 | - |
| Sma3 | Zinc finger, SWIM-type | IPR007527 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, catalytic | IPR009007 | - | 0.0 | - |
| Sma3 | Homeobox, conserved site | IPR017970 | - | 0.0 | - |
| Sma3 | DNA methylase, N-4 cytosine-specific, conserved site | IPR017985 | - | 0.0 | - |
| Sma3 | Aldo/keto reductase, conserved site | IPR018170 | - | 0.0 | - |
| Sma3 | MULE transposase domain | IPR018289 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| RefSeq | Populus trichocarpa | XP_002336419.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-11 | 51% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5BXG5
Fln msg: Distance to subject end: 19 aas, your sequence is shorter than subject: 58 - 138
Fln protein:
T
Protein Length:
59
Fln nts:
C
Fln Alignment:
HA8LWWM01C6P45___TFTRPWRTYAY*VLPFGLCNEPVTFQRAILGIFSDLIHDCVEVYMDDFTVYRNYFEE
A5BXG5________________TFTCPFRTYAYRRMPFGLCNAPATFQRCMLSIFSDMVERIMEVFMDDITIYGGTFEE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
