UniGene Name: sp_v3.0_unigene163333
Length: 241 nt
![]() |
---|
>sp_v3.0_unigene163333
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Nucleosome remodeling factor, p48 subunit n=1 Tax=Physcomitrella patens subsp. patens RepID=A9RJC1_PHYPA | - | - | 1.0e-27 | 71% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Sma3 | Nucleosome/chromatin assembly factor group | - | - | 6.675e-10 | - |
Source | Gene names |
---|---|
Sma3 | At5g58230; B1394A07.14; CHLREDRAFT_131412; GSVIVT00030810001; GSVIVT00036121001; LOC_Os03g43890; MCK7.10; MICPUCDRAFT_49651; MICPUN_86547; MSI1; NFC1501; NFC901; NFC902; NFC903; NFC904; OSTLU_26671; Os03g0640100; OsI_12765; OsJ_11856; Ot12g00130; PHYPADRA |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chromatin remodeling complex | GO:0016585 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | DNA replication | GO:0006260 | Biological Process | 0.0 | - |
Sma3 | regulation of gene expression by genetic imprinting | GO:0006349 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | cell proliferation | GO:0008283 | Biological Process | 0.0 | - |
Sma3 | pollen development | GO:0009555 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | regulation of flower development | GO:0009909 | Biological Process | 0.0 | - |
Sma3 | trichome differentiation | GO:0010026 | Biological Process | 0.0 | - |
Sma3 | seed coat development | GO:0010214 | Biological Process | 0.0 | - |
Sma3 | heterochromatin assembly | GO:0031507 | Biological Process | 0.0 | - |
Sma3 | positive regulation of cell cycle | GO:0045787 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
Sma3 | WD40-repeat-containing domain | IPR017986 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Sma3 | IPR019782 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G58230.1 | MSI1, MEE70, ATMSI1 Transducin/WD40 repeat-like superfamily protein chr5:23556112-23557994 FORWARD LENGTH=424 | 2.0e-31 | 65% |
RefSeq | Arabidopsis thaliana | NP_200631.1 | histone-binding protein RBBP4 [Arabidopsis thaliana] | 2.0e-31 | 65% |
RefSeq | Populus trichocarpa | XP_002302832.1 | nucleosome/chromatin assembly factor group [Populus trichocarpa] | 4.0e-33 | 69% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LS29
Fln msg: Distance to subject end: 96 aas, your sequence is shorter than subject: 80 - 421
Fln protein:
S
Protein Length:
81
Fln nts:
T
Fln Alignment:
HA8LWWM01CTATY___SVGDDHHLLLWDIRNDS-EKPLHIVEAHQAEVNCLAFNPFNEWIVATGSADRTVALHDIRKLDKVLHTCAHHIEEVFQIGW
B8LS29________________SVGDDRHLLIWDLRTSAANKPLHSVVAHQGEVNCLAFNPFNEWVLATGSADRTVKLFDLRKITSALHTFSCHKEEVFQIGW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain