|
||||||
|
UniGene Name: sp_v3.0_unigene163323
Length: 245 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene163323
T |
|
Ace file of the UniGene sp_v3.0_unigene163323
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Superoxide dismutase n=1 Tax=Ginkgo biloba RepID=B8YNX9_GINBI | - | - | 2.0e-20 | 48% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 71% |
| Sma3 | Superoxide dismutase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Superoxide dismutase. | EC:1.15.1.1 | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | 57h21.30; At4g25100; At5g23310; CHLREDRAFT_182933; F13M23.240; FESOD; FSD1; FSD3; Fe-SOD; Fe-SODb; FeSOD; Fesod; GSVIVT00007083001; GSVIVT00014163001; Os06g0143000; OsI_21593; OsJ_20091; P0535G04.31; PHYPADRAFT_105032; PHYPADRAFT_26510; RCOM_0808700; RCOM |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | nucleoid | GO:0009295 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | superoxide dismutase activity | GO:0004784 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
| Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
| Sma3 | superoxide metabolic process | GO:0006801 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | circadian rhythm | GO:0007623 | Biological Process | 0.0 | - |
| Sma3 | response to copper ion | GO:0046688 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Manganese/iron superoxide dismutase | IPR001189 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G23310.1 | FSD3 Fe superoxide dismutase 3 chr5:7850624-7852241 FORWARD LENGTH=263 | 3.0e-25 | 73% |
| RefSeq | Arabidopsis thaliana | NP_197722.1 | Fe superoxide dismutase 3 [Arabidopsis thaliana] | 4.0e-25 | 73% |
| RefSeq | Populus trichocarpa | XP_002322315.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-20 | 57% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5ACX3
Fln msg: Distance to subject end: 145 aas, atg_distance in limit (1-15): atg_distance = 2, W2: There is no M at the beginning, your sequence is shorter than subject: 81 - 253
Fln protein:
A
Protein Length:
82
Fln nts:
T
Fln Alignment:
HA8LWWM01CFNW1___ALLQHSLLLQHRPLHSNIFRSKTKT--------------------------DALEPFISRRSLEFHWGKHHRGYVDNLNKQIEGNELEGFTLEELIKVTYNNGNPMP
D5ACX3________________ALLQHSLLLQHRPLHTNIFRTKTKTRGAMLRSRMAPLTVALFGLKEPPYKLDALEPFMSRRTLEFHWGKHHRGYVDNLNKQIEGNELEGFTLEELIKVTYNNGNPMP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
