|
||||||
|
UniGene Name: sp_v3.0_unigene163257
Length: 224 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene163257
A |
|
Ace file of the UniGene sp_v3.0_unigene163257
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | MYB transcription factor MYB181 [Glycine max] gb|ACU14259.1| unknown [Glycine max] | - | - | 2.0e-30 | 78% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 78% |
| Sma3 | MYB transcription factor | - | - | 1.15e-28 | - |
| Source | Gene names |
|---|---|
| Sma3 | AIM1; AT4g13480; At1g25340; At1g48000; At1g68320; At2g16720; At2g32460; At2g47190; At2g47460; At3g01530; At3g01530/F4P13_8; At3g06490; At3g24310; At3g27810; At3g30210; At3g46130; At3g53200; At3g53200/T4D2_130; At4g13480; At4g22680; At5g40350; At5g49620; A |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | calmodulin binding | GO:0005516 | Molecular Function | 0.0 | - |
| Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | red, far-red light phototransduction | GO:0009585 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
| Sma3 | gibberellic acid mediated signaling pathway | GO:0009740 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of abscisic acid mediated signaling pathway | GO:0009789 | Biological Process | 0.0 | - |
| Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
| Sma3 | red or far-red light signaling pathway | GO:0010017 | Biological Process | 0.0 | - |
| Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | stamen development | GO:0048443 | Biological Process | 0.0 | - |
| Sma3 | flavonol biosynthetic process | GO:0051555 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
| Sma3 | Phosphoglycerate/bisphosphoglycerate mutase, active site | IPR001345 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | IPR014778 | - | 0.0 | - | |
| Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
| Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
| Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G27810.1 | ATMYB21, ATMYB3, MYB21 myb domain protein 21 chr3:10307596-10310093 FORWARD LENGTH=226 | 9.0e-39 | 74% |
| RefSeq | Arabidopsis thaliana | NP_189418.2 | transcription factor MYB21 [Arabidopsis thaliana] | 1.0e-38 | 74% |
| RefSeq | Populus trichocarpa | XP_002323803.1 | predicted protein [Populus trichocarpa] | 7.00005e-41 | 79% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLD7
Fln msg: Distance to subject end: 180 aas, your sequence is shorter than subject: 74 - 295
Fln protein:
N
Protein Length:
75
Fln nts:
A
Fln Alignment:
HA8LWWM01B8SN6___LAKAAGLKRSGKSCRLRWVNYLRPDLKRGDITPDEERLIIDLQGRWGNRWSRIAKRLPGRTDNEIKNYWRT
B8LLD7________________LAKASGLQRCGKSCRLRWVNYLRPDLKRGSITPEEESIILDLHARWGNRWSLIAEKMPGRTDNEIKNYWRS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
