UniGene Name: sp_v3.0_unigene163182
Length: 194 nt
UniGene Fasta |
---|
>sp_v3.0_unigene163182
G |
Ace file of the UniGene sp_v3.0_unigene163182 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | GRP94 n=2 Tax=Pinaceae RepID=A7YAU9_PINTA | - | - | 2.0e-19 | 87% |
FL-Next | tr=GRP94; Pinus taeda (Loblolly pine). | - | - | 0.0 | 87% |
Sma3 | GRP94 homolog | - | - | 6.418e-13 | - |
Source | Gene names |
---|---|
Sma3 | At4g24190; CHLREDRAFT_97057; GSVIVT00014401001; HSP90; HSP90-7; HSP90B; OJ1540_H01.1; Os06g0716700; OsI_24473; OsJ_22671; P0481E08.35; P0541C02.2; PHYPADRAFT_216220; PHYPADRAFT_65832; POPTRDRAFT_818818; RCOM_1598250; SHD; T19F6.1; T22A6.20; VITISV_028074; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | unfolded protein binding | GO:0051082 | Molecular Function | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | protein secretion | GO:0009306 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | regulation of meristem structural organization | GO:0009934 | Biological Process | 0.0 | - |
Sma3 | regulation of meristem growth | GO:0010075 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribosomal protein L28 | IPR001383 | - | 0.0 | - |
Sma3 | Heat shock protein Hsp90 | IPR001404 | - | 0.0 | - |
Sma3 | ATPase-like, ATP-binding domain | IPR003594 | - | 0.0 | - |
Sma3 | Molecular chaperone, heat shock protein, endoplasmin | IPR015566 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G24190.1 | SHD, HSP90.7, AtHsp90.7, AtHsp90-7 Chaperone protein htpG family protein chr4:12551902-12555851 REVERSE LENGTH=823 | 5.0e-19 | 70% |
RefSeq | Arabidopsis thaliana | NP_974606.1 | endoplasmin-like protein [Arabidopsis thaliana] | 6.0e-19 | 70% |
RefSeq | Populus trichocarpa | XP_002307732.1 | predicted protein [Populus trichocarpa] | 2.0e-19 | 70% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A7YAU9
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 562 aas, your sequence is shorter than subject: 58 - 834
Fln protein:
V
Protein Length:
59
Fln nts:
G
Fln Alignment:
HA8LWWM01CSMDG___VANHVEVISKNNDDKQYIQESKVDGVFVVSEDTENEPLGRRTEIRLHLKDEASK
A7YAU9________________VADHVEVISKNNDDKQYIWESKADGAFAVSEDTENEPLGRGTEIRLHLKDEASE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain