|
||||||
|
UniGene Name: sp_v3.0_unigene162907
Length: 219 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene162907
A |
|
Ace file of the UniGene sp_v3.0_unigene162907
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Properoxidase n=1 Tax=Picea abies RepID=Q0JW34_PICAB | - | - | 3.0e-24 | 76% |
| FL-Next | tr=Properoxidase; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 76% |
| Sma3 | Peroxidase | - | - | 1.613e-18 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peroxidase. | EC:1.11.1.7 | - | 3.788e-15 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 3.788e-15 | % | |
| Sma3 | Methane metabolism | 00680 | 3.788e-15 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 3.788e-15 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 3.788e-15 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.788e-15 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.788e-15 | % |
| Source | Gene names |
|---|---|
| Sma3 | GSVIVT00015159001; GSVIVT00029403001; LOC_Os03g32050; LOC_Os11g02100; LOC_Os12g02060; OSJNBb0013C14.9; Os03g0434500; Os11g0112200; OsI_12176; OsI_34838; OsI_37207; OsJ_11383; OsJ_32691; OsJ_34979; POPTRDRAFT_836853; PRX1; pod3; prx1; prx131; prx136; prx2; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
| Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
| Sma3 | Thymidylate kinase, conserved site | IPR018095 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G05340.1 | Peroxidase superfamily protein chr5:1579142-1580819 REVERSE LENGTH=324 | 7.0e-18 | 60% |
| RefSeq | Arabidopsis thaliana | NP_196153.1 | peroxidase 52 [Arabidopsis thaliana] | 1.0e-17 | 60% |
| RefSeq | Populus trichocarpa | XP_002328991.1 | predicted protein [Populus trichocarpa] | 1.0e-19 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: Q0JW34
Fln msg: Overlapping hits, possible frame ERROR between 122 and 110, STOP codon was not found. Distance to subject end: 1 aas, your sequence is shorter than subject: 72 - 310
Fln protein:
N
Protein Length:
73
Fln nts:
A
Fln Alignment:
HA8LWWM01CQRE6___NYYNNLKIKKGLLHSDQEIFNGGSTDSEVTLYSTNxxxxFSDFAAAIVKMGNIKPLTGSSGEIRKNCRQPN
Q0JW34________________NYYSNLKSKKGLLHSDQELFNGGSTDSQVTTYASNxxxxFSDFAAAMVKMGNIKPLTGTSGQIRKNCRKPN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
