UniGene Name: sp_v3.0_unigene162878
Length: 226 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene162878
A |
Ace file of the UniGene sp_v3.0_unigene162878
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Properoxidase n=1 Tax=Picea abies RepID=Q0JW34_PICAB | - | - | 2.0e-30 | 91% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
| Sma3 | Peroxidase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peroxidase. | EC:1.11.1.7 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 0.0 | % | |
| Sma3 | Methane metabolism | 00680 | 0.0 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g49570; At4g16270; At5g05340; At5g58390; At5g58400; F14J22.19; FBP5; FCAALL.329; FLXPER1; GSVIVT00015157001; GSVIVT00015158001; GSVIVT00015159001; GSVIVT00015160001; GSVIVT00018769001; GSVIVT00018771001; GSVIVT00023967001; GSVIVT00023969001; GSVIVT0002 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
| Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
| Sma3 | Alpha-N-acetylglucosaminidase | IPR007781 | - | 0.0 | - |
| Sma3 | GCN5-like 1 | IPR009395 | - | 0.0 | - |
| Sma3 | Thymidylate kinase, conserved site | IPR018095 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G05340.1 | Peroxidase superfamily protein chr5:1579142-1580819 REVERSE LENGTH=324 | 2.0e-30 | 72% |
| RefSeq | Arabidopsis thaliana | NP_196153.1 | peroxidase 52 [Arabidopsis thaliana] | 3.0e-30 | 72% |
| RefSeq | Populus trichocarpa | XP_002319407.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-33 | 79% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NZA1
Fln msg: Distance to subject end: 165 aas, your sequence is shorter than subject: 74 - 323
Fln protein:
D
Protein Length:
75
Fln nts:
A
Fln Alignment:
HA8LWWM01D47G1___DSSKITGEKTAIPNANSARGFDVIDTIKSQVEKSCSAVVSCADILAIAARDSVVELGGPSWTVMLGRRDSTTAS
A9NZA1________________DSSKITGEKTAVPNANSARGFDVIDTIKSQVEKSCSGVVSCADILAIAARDSVVELGGPSWTVLLGRRDSTTAS

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta