UniGene Name: sp_v3.0_unigene162789
Length: 165 nt
![]() |
---|
>sp_v3.0_unigene162789
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | MYBR domain class transcription factor n=1 Tax=Malus x domestica RepID=D9ZJ79_MALDO | - | - | 1.0e-16 | 75% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 72% |
Sma3 | MYB transcription factor | - | - | 3.077e-25 | - |
Source | Gene names |
---|---|
Sma3 | 1-3-1A; 1-3-1B; 24.t00021; 26.t00038; 31.t00060; 40.t00014; AT1G19000; AT1G74840; At1g19000; At1g49010; At1g70000; At1g74840; At2g38090; At3g11280; At3g16350; At5g04760; At5g05790; At5g08520; At5g47390; At5g56840; At5g58900; At5g58900/k19m22_100; At5g6162 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
Sma3 | Parathyroid hormone/parathyroid hormone-related protein | IPR001415 | - | 0.0 | - |
Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | ABC-1 | IPR004147 | - | 0.0 | - |
Sma3 | Myb DNA-binding domain, plants | IPR006447 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | IPR014778 | - | 0.0 | - | |
Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
Sma3 | IPR015609 | - | 0.0 | - | |
Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
Sma3 | SANT domain | IPR017884 | - | 0.0 | - |
Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
Sma3 | DNA methylase, N-4 cytosine-specific, conserved site | IPR017985 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G70000.1 | myb-like transcription factor family protein chr1:26363674-26364635 REVERSE LENGTH=261 | 1.0e-20 | 72% |
RefSeq | Arabidopsis thaliana | NP_001185398.1 | myb family transcription factor [Arabidopsis thaliana] | 1.0e-20 | 72% |
RefSeq | Populus trichocarpa | XP_002312695.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-22 | 75% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLJ2
Fln msg: Distance to subject end: 234 aas, your sequence is shorter than subject: 54 - 361
Fln protein:
V
Protein Length:
55
Fln nts:
C
Fln Alignment:
HA8LWWM01EU07H___NGHQTRKGMTWSEEEHGLFLVGLQRLGRGDWRGISRNFVKTRTPTQVASHA
B8LLJ2________________NARERKRGVPWTEEEHRMFLVGLQKVGKGDWRGISRNFVKTRTPTQVASHA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain