UniGene Name: sp_v3.0_unigene162418
Length: 193 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene162418
C |
Ace file of the UniGene sp_v3.0_unigene162418
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Class III peroxidase n=2 Tax=Gossypium hirsutum RepID=A8W7V9_GOSHI | - | - | 2.0e-15 | 70% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
| Sma3 | Peroxidase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peroxidase. | EC:1.11.1.7 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 0.0 | % | |
| Sma3 | Methane metabolism | 00680 | 0.0 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g44970; At1g49570; At2g22420; At2g35380; At3g50990; At4g16270; At5g05340; At5g19890; At5g58390; At5g58400; At5g64120; At5g66390; F14J22.19; F14M13.18; F24M12.30; F27F5.6; F28I16.40; FCAALL.329; GSVIVT00004405001; GSVIVT00014550001; GSVIVT00015157001; G |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | respiratory burst | GO:0045730 | Biological Process | 0.0 | - |
| Sma3 | rhythmic process | GO:0048511 | Biological Process | 0.0 | - |
| Sma3 | defense response to fungus | GO:0050832 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | GPCR, rhodopsin-like, 7TM | IPR000276 | - | 0.0 | - |
| Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
| Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
| Sma3 | Alpha-N-acetylglucosaminidase | IPR007781 | - | 0.0 | - |
| Sma3 | GCN5-like 1 | IPR009395 | - | 0.0 | - |
| Sma3 | Thymidylate kinase, conserved site | IPR018095 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G16270.1 | Peroxidase superfamily protein chr4:9205038-9206483 FORWARD LENGTH=362 | 9.0e-21 | 69% |
| RefSeq | Arabidopsis thaliana | NP_193362.2 | peroxidase 40 [Arabidopsis thaliana] | 1.0e-20 | 69% |
| RefSeq | Populus trichocarpa | XP_002312317.1 | predicted protein [Populus trichocarpa] | 2.0e-20 | 67% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NP92
Fln msg: Distance to subject end: 184 aas, your sequence is shorter than subject: 63 - 338
Fln protein:
A
Protein Length:
64
Fln nts:
C
Fln Alignment:
HA8LWWM01A9JKU___ATFEGEKTTGLNLNSSSGFEVIDYIKEELESACPAQVSCADILAMAARDSVVLTRGPYWEVSL
A9NP92________________STFEGEKTAAPNLNSIRGFEVIDAIKEELEAACPENVSCADILAMAARDSVVITGGPSWEVLL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta