UniGene Name: sp_v3.0_unigene162333
Length: 163 nt
![]() |
---|
>sp_v3.0_unigene162333
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Metal transport protein n=1 Tax=Medicago truncatula RepID=Q6VM15_MEDTR | - | - | 5.0e-19 | 81% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
Sma3 | Putative zinc transporter | - | - | 7.889e-17 | - |
Source | Gene names |
---|---|
Sma3 | 12.t00028; 12.t00049; At1g55910; At5g59520; F14J16.16; GSVIVT00024285001; GSVIVT00033348001; GSVIVT00033350001; GSVIVT00033352001; GSVIVT00033353001; LOC_Os03g29850; MtrDRAFT_AC157503g1v2; Os01g0972200; Os03g0411800; Os03g29850; OsI_05391; OsI_05394; OsI_ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | transposase activity | GO:0004803 | Molecular Function | 0.0 | - |
Sma3 | copper ion transmembrane transporter activity | GO:0005375 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | metal ion transmembrane transporter activity | GO:0046873 | Molecular Function | 0.0 | - |
Sma3 | transposition, DNA-mediated | GO:0006313 | Biological Process | 0.0 | - |
Sma3 | zinc ion transport | GO:0006829 | Biological Process | 0.0 | - |
Sma3 | metal ion transport | GO:0030001 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | Transposase, IS4-like | IPR002559 | - | 0.0 | - |
Sma3 | Zinc/iron permease | IPR003689 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF1117 | IPR010543 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Zinc finger, C3HC4 RING-type | IPR018957 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G55910.1 | ZIP11 zinc transporter 11 precursor chr1:20906161-20907225 FORWARD LENGTH=326 | 9.0e-21 | 71% |
RefSeq | Arabidopsis thaliana | NP_564703.1 | zinc transporter 11 [Arabidopsis thaliana] | 1.0e-20 | 71% |
RefSeq | Populus trichocarpa | XP_002300374.1 | ZIP transporter [Populus trichocarpa] | 8.0e-24 | 79% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NZA5
Fln msg: Distance to subject end: 50 aas, your sequence is shorter than subject: 54 - 358
Fln protein:
S
Protein Length:
55
Fln nts:
A
Fln Alignment:
HA8LWWM01A4DZY___IIPSRPFLSCAGYAFAFAISSPIGVAIGILIDATTQGHVADWIYAISMGFACG
A9NZA5________________IIPNRPFLSCAAYAFAFAISSPVGVAIGILIDATTQGHVADWIYAISMGFACG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain