UniGene Name: sp_v3.0_unigene162270
Length: 224 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene162270
A |
Ace file of the UniGene sp_v3.0_unigene162270
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative apyrase [Oryza sativa Japonica Group] gb|ABF95735.1| Nucleoside-triphosphatase, putative, expressed [Oryza sativa Japonica Group] | - | - | 2.0e-21 | 63% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 66% |
| Sma3 | Apyrase | - | - | 2.377e-28 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Nucleoside-triphosphatase. | EC:3.6.1.15 | - | 5.329e-08 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 5.329e-08 | % | |
| Sma3 | Thiamine metabolism | 00730 | 5.329e-08 | % | |
| Sma3 | Metabolic pathways | 01100 | 5.329e-08 | % | |
| Sma3 | Apyrase. | EC:3.6.1.5 | - | 1.076e-15 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 1.076e-15 | % | |
| Sma3 | Pyrimidine metabolism | 00240 | 1.076e-15 | % |
| Source | Gene names |
|---|---|
| Sma3 | APY1; APY2; ATP diphosphohydrolase; Apy2; At3g04080; At5g18280; Atapy1; Atapy2; GSVIVT00034786001; LNP; LOC_Os03g21120; LOC_Os11g03230; LOC_Os11g03270; LOC_Os11g03290; LOC_Os11g25260; LOC_Os11g25330; LOC_Os12g02980; MICPUN_84198; OSJNBa0060O17.4; OSJNBb00 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | hydrolase activity | GO:0016787 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
| Sma3 | pollen germination | GO:0009846 | Biological Process | 0.0 | - |
| Sma3 | mRNA transport | GO:0051028 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Nucleoside phosphatase GDA1/CD39 | IPR000407 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G18280.2 | - | 2.0e-25 | 63% |
| RefSeq | Arabidopsis thaliana | NP_197329.4 | nucleoside-triphosphatase [Arabidopsis thaliana] | 2.0e-25 | 63% |
| RefSeq | Populus trichocarpa | XP_002319138.1 | predicted protein [Populus trichocarpa] | 2.0e-27 | 69% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9P214
Fln msg: STOP codon was not found. Distance to subject end: 37 aas, your sequence is shorter than subject: 74 - 171
Fln protein:
I
Protein Length:
75
Fln nts:
A
Fln Alignment:
HA8LWWM01CUO65___ILEAVRTLISSTTPFKFEKGWVSILDGSQEGSFMWI
A9P214________________ILAAVRKLFSHNTTFKFEEGWVSLLEGNQEGAFMWV

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta