SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene161913

Length: 335 nt

UniGene Fasta

>sp_v3.0_unigene161913
CAAAACTTCCTCCTCCCAATTCAACTTTCTCGAAACTGAAATCAATATTTGCCAGCAATGGTCTTGATGTTAAGGATTTGGTTGTGTTGTCTGGCGGACACACAATAGGGATATCTCACTGCAACTCCTTTAGCGGCAGGCTGTACAATTTTACAGGAAAAGGAGATATGGATCCGTCCTTGGATAAAAATTATGCAGCTCGGCTCAAGATAAAATGTAAACCCGGGGACAATAAGACAATAGTAGAGATGGATCCAGGTAGCTTTCGAACATTTGACACCAATTATTTCGTGAATGTAAAGAAGAATAGAGGCCTCTTTCAATCCGATGCTGCT

Ace file of the UniGene sp_v3.0_unigene161913

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	peroxidase 27 [Arabidopsis thaliana] sp\|Q43735.1\|PER27_ARATH RecName: Full=Peroxidase 27; Short=Atperox P27; AltName: Full=ATP12a; AltName: Full=PRXR7; Flags: Precursor gb\|AAF26155.1\|AC008261_12 putative peroxidase [Arabidopsis thaliana] emb\|CAA66963.1\| p	-	-	5.0e-35	65%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	93%
Sma3	Peroxidase 27, putative	-	-	2.581e-13	-

Source	ECs	Term	Type	e value	Identity
Sma3	Peroxidase.	EC:1.11.1.7	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Phenylalanine metabolism	00360	%
Sma3	Methane metabolism	00680	%
Sma3	Phenylpropanoid biosynthesis	00940	%
Sma3	Biosynthesis of phenylpropanoids	01061	%
Sma3	Metabolic pathways	01100	%
Sma3	Biosynthesis of secondary metabolites	01110	%

Source	Gene names
Sma3	At1g05240; At1g05250; At1g05260; At2g39040; At3g01190; At3g21770; At4g08780; At4g11290; At5g15180; B1386G10.20; F8L21.80; F8M21_70; GSVIVT00006924001; GSVIVT00019842001; GSVIVT00019843001; GSVIVT00023610001; GSVIVT00026051001; GSVIVT00026052001; GSVIVT000

Source	GOs	Term	Type	Identity
Sma3	extracellular region	GO:0005576	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	plant-type cell wall	GO:0009505	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	peroxidase activity	GO:0004601	Molecular Function	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	calcium ion binding	GO:0005509	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	response to desiccation	GO:0009269	Biological Process	-
Sma3	response to cold	GO:0009409	Biological Process	-
Sma3	hyperosmotic salinity response	GO:0042538	Biological Process	-
Sma3	hydrogen peroxide catabolic process	GO:0042744	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Plant peroxidase	IPR000823	-	-
Sma3	Haem peroxidase, plant/fungal/bacterial	IPR002016	-	-
Sma3	Peroxidases heam-ligand binding site	IPR019793	-	-
Sma3	Peroxidase, active site	IPR019794	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G01190.1	Peroxidase superfamily protein chr3:67236-68477 REVERSE LENGTH=321	1.96182e-44	65%
RefSeq	Arabidopsis thaliana	NP_186768.1	peroxidase 27 [Arabidopsis thaliana]	1.96182e-44	65%
RefSeq	Populus trichocarpa	XP_002309830.1	predicted protein [Populus trichocarpa]	0.0	67%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9P1P4

Fln msg: Distance to subject end: 52 aas, your sequence is shorter than subject: 111 - 324

Fln protein: KLPPPNSTFSKLKSIFASNGLDVKDLVVLSGGHTIGISHCNSFSGRLYNFTGKGDMDPSLDKNYAARLKIKCKPGDNKTIVEMDPGSFRTFDTNYFVNVKKNRGLFQSDAA

Protein Length: 112

Fln nts: CAAAACTTCCTCCTCCCAATTCAACTTTCTCGAAACTGAAATCAATATTTGCCAGCAATGGTCTTGATGTTAAGGATTTGGTTGTGTTGTCTGGCGGACACACAATAGGGATATCTCACTGCAACTCCTTTAGCGGCAGGCTGTACAATTTTACAGGAAAAGGAGATATGGATCCGTCCTTGGATAAAAATTATGCAGCTCGGCTCAAGATAAAATGTAAACCCGGGGACAATAAGACAATAGTAGAGATGGATCCAGGTAGCTTTCGAACATTTGACACCAATTATTTCGTGAATGTAAAGAAGAATAGAGGCCTCTTTCAATCCGATGCTGCT

Fln Alignment:

HA8LWWM01CJ56N___KLPPPNSTFSKLKSIFASNGLDVKDLVVLSGGHTIGISHCNSFSGRLYNFTGKGDMDPSLDKNYAARLKIKCKPGDNKTIVEMDPGSFRTFDTNYFVNVKKNRGLFQSDAA
A9P1P4________________KLPPPNGTFSKLKSIFASNGLDVKDLVVLSGGHTIGMSHCNSFSSRLYNFTGKGDMDPSLDKSYAAHLKIKCKPGDNKTIVEMDPGSFRTFDTHYYVNVKKNRGLFQSDAA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain