UniGene Name: sp_v3.0_unigene161885
Length: 220 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene161885
A |
Ace file of the UniGene sp_v3.0_unigene161885
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Poly [ADP-ribose] polymerase, putative n=1 Tax=Ricinus communis RepID=B9S4L5_RICCO | - | - | 1.0e-26 | 77% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
| Sma3 | Poly[ADP-ribose] synthetase 1 | - | - | 4.394e-13 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | EC:2.4.2.3- | - | 9.662e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g31320; F16D14.16; GSVIVT00007500001; LOC_Os07g23110; OSJNBa0077F02.113; Os07g0413700; OsI_25738; OsJ_23951; PARP1; PHYPADRAFT_188096; POPTRDRAFT_830081; RCOM_0993250; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | NAD+ ADP-ribosyltransferase activity | GO:0003950 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
| Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
| Sma3 | protein ADP-ribosylation | GO:0006471 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | response to abiotic stimulus | GO:0009628 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | BRCT domain | IPR001357 | - | 0.0 | - |
| Sma3 | Zinc finger, PARP-type | IPR001510 | - | 0.0 | - |
| Sma3 | DNA-binding SAP | IPR003034 | - | 0.0 | - |
| Sma3 | Poly(ADP-ribose) polymerase, regulatory domain | IPR004102 | - | 0.0 | - |
| Sma3 | NAD+ ADP-ribosyltransferase | IPR008288 | - | 0.0 | - |
| Sma3 | WGR domain | IPR008893 | - | 0.0 | - |
| Sma3 | Poly(ADP-ribose) polymerase, catalytic domain | IPR012317 | - | 0.0 | - |
| Sma3 | PADR1 | IPR012982 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G31320.1 | PARP2, ATPARP2 poly(ADP-ribose) polymerase 2 chr2:13354046-13359578 REVERSE LENGTH=983 | 2.0e-30 | 72% |
| RefSeq | Populus trichocarpa | XP_002302058.1 | predicted protein [Populus trichocarpa] | 4.0e-33 | 77% |
Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAL4
Fln msg: Distance to subject end: 400 aas, your sequence is shorter than subject: 55 - 456
Fln protein:
M
Protein Length:
56
Fln nts:
A
Fln Alignment:
HA8LWWM01E2AXB___MSDLSTGINSYYILQVIEDDKKTGCHVFRKWGRVGNSKIGGQKLEKMPKLAAIHE
D5AAL4________________MSDLSTGINSYYILQVIEDDKKAGCHVFRKWGRVGNSKIGGQKLEKMPKLAAIRE

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta