UniGene Name: sp_v3.0_unigene161725
Length: 216 nt
UniGene Fasta |
---|
>sp_v3.0_unigene161725
T |
Ace file of the UniGene sp_v3.0_unigene161725 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Retrotransposon protein, putative, unclassified n=3 Tax=Oryza sativa Japonica Group RepID=Q2R6F1_ORYSJ | - | - | 2.0e-17 | 60% |
FL-Next | sp=Uncharacterized mitochondrial protein AtMg00860; Arabidopsis thaliana (Mouse-ear cress). Mitochondrion. | - | - | 0.0 | 49% |
Source | Gene names |
---|---|
Sma3 | LOC_Os03g05350; LOC_Os11g20270; LOC_Os12g24780; OSIGBa0114M03.4; OSJNBa0059D20.8; OSJNBa0067N01.10; Os04g0191000; Os06g0570000; Os06g0590100; Os09g0135100; VITISV_011880; VITISV_013041; VITISV_043911; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
Sma3 | MULE transposase domain | IPR018289 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | ATMG00860.1 | ORF158 DNA/RNA polymerases superfamily protein chrM:235916-236392 FORWARD LENGTH=158 | 1.0e-12 | 49% |
RefSeq | Arabidopsis thaliana | NP_085542.1 | hypothetical protein ArthMp075 (mitochondrion) [Arabidopsis thaliana] | 1.0e-12 | 49% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: sp_plants
Fln subject: P92523
Fln msg: STOP codon was not found. Distance to subject end: 15 aas, your sequence is shorter than subject: 72 - 158
Fln protein:
L
Protein Length:
73
Fln nts:
T
Fln Alignment:
HA8LWWM01BHGZV___LTGYYSKFVKNYGRIATPLTTLLKKDAFSWTLEATKAFGHIKEVMCQALVLATSDFTKTFI
P92523________________LTGYYRRFVKNYGKIVRPLTELLKKNSLKWTEMAALAFKALKGAVTTLPVLALPDLKLPFV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain