UniGene Name: sp_v3.0_unigene161553
Length: 235 nt
![]() |
---|
>sp_v3.0_unigene161553
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DUF659 domain containing protein | - | - | 2.0e-30 | 61% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 55% |
Source | Gene names |
---|---|
Sma3 | GSVIVT00000858001; GSVIVT00001531001; GSVIVT00002235001; GSVIVT00003156001; GSVIVT00010563001; GSVIVT00012683001; GSVIVT00014165001; GSVIVT00014176001; GSVIVT00022661001; GSVIVT00024230001; GSVIVT00029236001; GSVIVT00031007001; GSVIVT00031266001; GSVIVT00 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | photosystem I | GO:0009522 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | photosynthesis | GO:0015979 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Neuraxin/MAP1B repeat | IPR000102 | - | 0.0 | - |
Sma3 | Photosystem I PsaA/PsaB | IPR001280 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 1 | IPR001360 | - | 0.0 | - |
Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Zinc finger, BED-type predicted | IPR003656 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | HAT dimerisation | IPR008906 | - | 0.0 | - |
Sma3 | IPR011523 | - | 0.0 | - | |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
Sma3 | IPR015706 | - | 0.0 | - | |
Sma3 | Zinc finger, C2H2-like | IPR015880 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G31412.1 | hAT transposon superfamily protein chr5:11541463-11543768 REVERSE LENGTH=433 | 1.0e-16 | 46% |
RefSeq | Arabidopsis thaliana | NP_680273.1 | hAT family dimerization domain-containing protein [Arabidopsis thaliana] | 1.0e-16 | 46% |
RefSeq | Populus trichocarpa | XP_002329897.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-22 | 53% |
![]() |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5C171
Fln msg: Distance to subject end: 360 aas, your sequence is shorter than subject: 77 - 926
Fln protein:
P
Protein Length:
78
Fln nts:
G
Fln Alignment:
HA8LWWM01DQLCM___PKGTMFMKSVNASSHIKDAKLLCDLLDVFILEVGAKHVAQIITGNAANYVVAGKMLMEKHPTLFWTHCAAHCIDLML
A5C171________________PKGTLFLKSVDISGHADDAHYLFELLESVVLEVGLENVVQVITDSAASYVYAGRLLMAKYTTLFWSPCASFCIDKML
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain