UniGene Name: sp_v3.0_unigene161544
Length: 228 nt
![]() |
---|
>sp_v3.0_unigene161544
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Dimer_Tnp_hAT domain containing protein | - | - | 0.0001 | 26% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 66% |
Source | Gene names |
---|---|
Sma3 | GSVIVT00000858001; GSVIVT00001200001; GSVIVT00002028001; GSVIVT00010821001; GSVIVT00017198001; GSVIVT00022282001; GSVIVT00029236001; GSVIVT00034220001; GSVIVT00037067001; GSVIVT00037637001; VITISV_008710; VITISV_009403; VITISV_015896; VITISV_016801; VITIS |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycoside hydrolase, family 1 | IPR001360 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, BED-type predicted | IPR003656 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | HAT dimerisation | IPR008906 | - | 0.0 | - |
Sma3 | IPR011523 | - | 0.0 | - | |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2-like | IPR015880 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G33406.1 | hAT dimerisation domain-containing protein / transposase-related chr5:12676126-12678403 REVERSE LENGTH=509 | 1.0e-14 | 54% |
RefSeq | Arabidopsis thaliana | NP_680299.4 | hAT family dimerization domain-containing protein [Arabidopsis thaliana] | 1.0e-14 | 54% |
RefSeq | Populus trichocarpa | XP_002302801.1 | predicted protein [Populus trichocarpa] | 5.0e-11 | 51% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADK7
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 123 aas, your sequence is shorter than subject: 76 - 250
Fln protein:
N
Protein Length:
77
Fln nts:
A
Fln Alignment:
HA8LWWM01BA5BL___AQWWEAFGGHCPELQGFSIRILSQTCSASGCERNWSVFERIHNFTQRR
D5ADK7________________AYWWQQFGSQCHELHKFAVRILSQTCSAFGCERNWSVFERIHTKKRNR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain