|
||||||
|
UniGene Name: sp_v3.0_unigene161497
Length: 247 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene161497
A |
|
Ace file of the UniGene sp_v3.0_unigene161497
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Gag-protease-integrase-RT-RNaseH polyprotein n=1 Tax=Glycine max RepID=B5U9F7_SOYBN | - | - | 2.0e-35 | 91% |
| FL-Next | tr=Reverse transcriptase; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 45% |
| Sma3 | Transposon protein, putative, unclassified | - | - | 7.069e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g03810; G9-pp1; LOC_Os03g13700; LOC_Os03g24260; LOC_Os03g25890; LOC_Os11g36590; LOC_Os11g37710; LOC_Os11g39270; LOC_Os11g40460; LOC_Os11g44400; LOC_Os11g44530; LOC_Os12g19760; LOC_Os12g38280; OJ1264_A04.10; OSIGBa0092E09.8; OSIGBa0134H18.6; OSJNBa0027N |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | polygalacturonase activity | GO:0004650 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | peptidase activity | GO:0008233 | Molecular Function | 0.0 | - |
| Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity, transferring acyl groups other than amino-acyl groups | GO:0016747 | Molecular Function | 0.0 | - |
| Sma3 | transcription regulator activity | GO:0030528 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
| Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
| Sma3 | Cytosolic fatty-acid binding | IPR000463 | - | 0.0 | - |
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 28 | IPR000743 | - | 0.0 | - |
| Sma3 | S-locus glycoprotein | IPR000858 | - | 0.0 | - |
| Sma3 | IPR001092 | - | 0.0 | - | |
| Sma3 | BRCT domain | IPR001357 | - | 0.0 | - |
| Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
| Sma3 | Protease-associated domain, PA | IPR003137 | - | 0.0 | - |
| Sma3 | Transferase | IPR003480 | - | 0.0 | - |
| Sma3 | Apple-like | IPR003609 | - | 0.0 | - |
| Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
| Sma3 | Transposon, En/Spm-like | IPR004242 | - | 0.0 | - |
| Sma3 | FAR1 DNA binding domain | IPR004330 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Zinc finger, PMZ-type | IPR006564 | - | 0.0 | - |
| Sma3 | Parallel beta-helix repeat | IPR006626 | - | 0.0 | - |
| Sma3 | Zinc finger, SWIM-type | IPR007527 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Protein of unknown function DUF789 | IPR008507 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | Helix-loop-helix DNA-binding | IPR011598 | - | 0.0 | - |
| Sma3 | Pectin lyase fold | IPR012334 | - | 0.0 | - |
| Sma3 | Protein of unknown function DUF1675 | IPR012463 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | PAN-2 domain | IPR013227 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Intermediate filament protein, conserved site | IPR018039 | - | 0.0 | - |
| Sma3 | Transcription factor, fork head, conserved site | IPR018122 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | MULE transposase domain | IPR018289 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9M5J7
Fln msg: Distance to subject end: 216 aas, your sequence is shorter than subject: 82 - 542
Fln protein:
E
Protein Length:
83
Fln nts:
A
Fln Alignment:
HA8LWWM01DQBAR___DQCIYLKVSGSKICFLVLYVDDILLETNDKGLLHEVKQFLSKNFDMKDMGDASYVIGIKIHRDRFRGILSLSQETYI
Q9M5J7________________DHCVYSKQVGNHFIYVVLYVDDMLLVGNNMDVIKEVKSQLSSKFDMKDLGAANFILGMDIKRDRANRKLWLNQRKYV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
