UniGene Name: sp_v3.0_unigene161482
Length: 204 nt
![]() |
---|
>sp_v3.0_unigene161482
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | cysteine-rich receptor-like protein kinase 2 [Arabidopsis thaliana] sp|Q9CAL3.1|CRK2_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 2; Short=Cysteine-rich RLK2; Flags: Precursor gb|AAG52471.1|AC010796_10 putative protein kinase; 37247-3480 | - | - | 5.0e-20 | 72% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 65% |
Sma3 | Chromosome chr19 scaffold_4, whole genome shotgun sequence | - | - | 1.342e-18 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.271e-09 | - |
Sma3 | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 3.507e-06 | - |
Source | Gene names |
---|---|
Sma3 | AT4g03230; AT4g27300; At1g61610; At1g70520; At4g03230; At4g04500; At4g04570; At4g27300; At5g40380; B0808H03.2; B0808H03.3; B120; CRK2; CRK37; CRK40; CRK42; F18E5.10; F24J13.9; F4C21.16; F4H6.9; GSVIVT00002357001; GSVIVT00002361001; GSVIVT00002363001; GSVI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | response to light stimulus | GO:0009416 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G70520.1 | CRK2 cysteine-rich RLK (RECEPTOR-like protein kinase) 2 chr1:26584888-26587334 REVERSE LENGTH=649 | 1.0e-25 | 72% |
RefSeq | Arabidopsis thaliana | NP_177209.1 | cysteine-rich receptor-like protein kinase 2 [Arabidopsis thaliana] | 1.0e-25 | 72% |
RefSeq | Populus trichocarpa | XP_002316951.1 | predicted protein [Populus trichocarpa] | 1.0e-26 | 67% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLJ5
Fln msg: Distance to subject end: 29 aas, your sequence is shorter than subject: 67 - 505
Fln protein:
Y
Protein Length:
68
Fln nts:
T
Fln Alignment:
HA8LWWM01APD0E___YEYLPNKSLDHFIFDENLGNILDWQRRFDIVLGTASGLAYLHQESDIRIIHRDIKASNILLDHHFKP
B8LLJ5________________YEYLQNSSLDKIIFDITKRHLLDWRERYEIIVGTARGLAYLHEESEIRIIHRDIKASNILLDNKYRP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain