|
||||||
|
UniGene Name: sp_v3.0_unigene161165
Length: 211 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene161165
A |
|
Ace file of the UniGene sp_v3.0_unigene161165
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RNA helicase, putative n=2 Tax=Perkinsus marinus ATCC 50983 RepID=C5LBR0_9ALVE | - | - | 4.0e-22 | 66% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 66% |
| Sma3 | Dead box ATP-dependent RNA helicase, putative | - | - | 4.821e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Hydrolases, Acting on acid anhydrides, In phosphorous-containing anhydrides. | EC:3.6.1.- | - | 6.051e-30 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 6.051e-30 | % | |
| Sma3 | Lipopolysaccharide biosynthesis | 00540 | 6.051e-30 | % | |
| Sma3 | Folate biosynthesis | 00790 | 6.051e-30 | % | |
| Sma3 | Metabolic pathways | 01100 | 6.051e-30 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g31970; At1g55150; At3g01540; At3g06480; At3g58510; At4g33370; At5g14610; At5g63120; B1156H12.12-1; B1156H12.12-2; CHLREDRAFT_111269; CHLREDRAFT_118630; CHLREDRAFT_136376; CHLREDRAFT_136620; DBP2; DRH1; ER68; F14P22.100; F17M5.130; F24P17.2; F4P13.9; F |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent RNA helicase activity | GO:0004004 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | nuclear-transcribed mRNA catabolic process, nonsense-mediated decay | GO:0000184 | Biological Process | 0.0 | - |
| Sma3 | rRNA processing | GO:0006364 | Biological Process | 0.0 | - |
| Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G55150.1 | DEA(D/H)-box RNA helicase family protein chr1:20574634-20577141 FORWARD LENGTH=501 | 7.0e-28 | 64% |
| RefSeq | Arabidopsis thaliana | NP_175911.1 | DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis thaliana] | 1.0e-27 | 64% |
| RefSeq | Populus trichocarpa | XP_002327540.1 | predicted protein [Populus trichocarpa] | 5.0e-28 | 66% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKZ7
Fln msg: Distance to subject end: 66 aas, your sequence is shorter than subject: 70 - 504
Fln protein:
Y
Protein Length:
71
Fln nts:
A
Fln Alignment:
HA8LWWM01DZ5FO___AVSIHGDKTQGQRDYIMRLYKTGRCNILVATDLAARGLDVADIKFVINYDFPGQLEDYIHRVGRTGRA
B8LKZ7________________ALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDIKCVINYDFPGSMEDYVHRIGRTGRA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
