UniGene Name: sp_v3.0_unigene161154
Length: 215 nt
![]() |
---|
>sp_v3.0_unigene161154
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | UDP-glucosyltransferase (Fragment) n=7 Tax=Picea RepID=F1C8U2_PICAB | - | - | 1.0e-19 | 55% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 87% |
Sma3 | UDP-glucosyltransferase, putative | - | - | 4.144e-16 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Anthocyanidin 3-O-glucosyltransferase. | EC:2.4.1.115 | - | 3.331e-18 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Anthocyanin biosynthesis | 00942 | 3.331e-18 | % | |
Sma3 | Metabolic pathways | 01100 | 3.331e-18 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.331e-18 | % |
Source | Gene names |
---|---|
Sma3 | At1g22340; At1g22400; At2g18560; At2g18570; At2g36780; At2g36800; At3g50740; At5g03490; DOGT1; Eg7GT-A; F12E4_260; F12K8.26; F13K3.20; F18B3.20; GSVIVT00000586001; GSVIVT00014668001; GSVIVT00014670001; GSVIVT00017554001; GSVIVT00024656001; GSVIVT000246570 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | transferase activity, transferring hexosyl groups | GO:0016758 | Molecular Function | 0.0 | - |
Sma3 | coniferyl-alcohol glucosyltransferase activity | GO:0047209 | Molecular Function | 0.0 | - |
Sma3 | anthocyanidin 3-O-glucosyltransferase activity | GO:0047213 | Molecular Function | 0.0 | - |
Sma3 | trans-zeatin O-beta-D-glucosyltransferase activity | GO:0050403 | Molecular Function | 0.0 | - |
Sma3 | cis-zeatin O-beta-D-glucosyltransferase activity | GO:0050502 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | lignin metabolic process | GO:0009808 | Biological Process | 0.0 | - |
Sma3 | brassinosteroid metabolic process | GO:0016131 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | UDP-glucuronosyl/UDP-glucosyltransferase | IPR002213 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G03490.1 | UDP-Glycosyltransferase superfamily protein chr5:871550-872947 FORWARD LENGTH=465 | 7.0e-24 | 55% |
RefSeq | Arabidopsis thaliana | NP_195969.1 | UDP-glycosyltransferase-like protein [Arabidopsis thaliana] | 1.0e-23 | 55% |
RefSeq | Populus trichocarpa | XP_002333410.1 | predicted protein [Populus trichocarpa] | 8.0e-25 | 63% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPJ2
Fln msg: Distance to subject end: 63 aas, your sequence is shorter than subject: 71 - 498
Fln protein:
P
Protein Length:
72
Fln nts:
C
Fln Alignment:
HA8LWWM01BC716___PQLLILSHPSIGAFLSHCGWNSVLESLSMGIPMITWPMFADQPYNSKLLEEHMGVAIRICEGMNSVPDEED
B8LPJ2________________PQLLILSHPSIGAFLSHCGWNSTLESVSMGIPMITWPMIADQPYNSKLLEERLGVAIRICAGVNSVPNEEE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain