UniGene Name: sp_v3.0_unigene161088
Length: 221 nt
UniGene Fasta |
---|
>sp_v3.0_unigene161088
C |
Ace file of the UniGene sp_v3.0_unigene161088 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gb|AEC07904.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] | - | - | 2.0e-29 | 82% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 98% |
Source | Gene names |
---|---|
Sma3 | At2g26890; GSVIVT00016801001; LOC_Os10g42439; OSJNBa0003O19.5; Os10g0575200; OsI_34763; OsJ_32568; PHYPADRAFT_133871; PHYPADRAFT_163817; POPTRDRAFT_737553; RCOM_0925750; VITISV_014674; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | late endosome | GO:0005770 | Cellular Component | 0.0 | - |
Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | microsome | GO:0005792 | Cellular Component | 0.0 | - |
Sma3 | trans-Golgi network | GO:0005802 | Cellular Component | 0.0 | - |
Sma3 | heat shock protein binding | GO:0031072 | Molecular Function | 0.0 | - |
Sma3 | protein targeting to vacuole | GO:0006623 | Biological Process | 0.0 | - |
Sma3 | endosome organization | GO:0007032 | Biological Process | 0.0 | - |
Sma3 | vacuole organization | GO:0007033 | Biological Process | 0.0 | - |
Sma3 | amyloplast organization | GO:0009660 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | negative gravitropism | GO:0009959 | Biological Process | 0.0 | - |
Sma3 | response to starvation | GO:0042594 | Biological Process | 0.0 | - |
Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Heat shock protein DnaJ, N-terminal | IPR001623 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | VQ | IPR008889 | - | 0.0 | - |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | IPR015609 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G26890.1 | GRV2, KAM2 DNAJ heat shock N-terminal domain-containing protein chr2:11462327-11473841 REVERSE LENGTH=2554 | 6.0e-36 | 82% |
RefSeq | Arabidopsis thaliana | NP_180257.3 | DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] | 8.0e-36 | 82% |
RefSeq | Populus trichocarpa | XP_002324963.1 | predicted protein [Populus trichocarpa] | 1.99993e-41 | 89% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AB41
Fln msg: Distance to subject end: 59 aas, your sequence is shorter than subject: 73 - 251
Fln protein:
L
Protein Length:
74
Fln nts:
C
Fln Alignment:
HA8LWWM01BG5G9___LVEVLLGLLDWRAGGTHGLCMQMKWNESEASVGRVLAVEVLHAFATEGAHCAKVRNILNASDVWSAYKDQKHD
D5AB41________________LVEVLLGLLDWRAGGTHGLCTQMKWNESEASVGRVLAVEVLHAFATEGAHCAKVRNILNASDVWSAYKDQKHD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain