|
||||||
|
UniGene Name: sp_v3.0_unigene160809
Length: 247 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene160809
T |
|
Ace file of the UniGene sp_v3.0_unigene160809
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | inositol-1, 4, 5-trisphosphate 5-Phosphatase-like protein [Arabidopsis thaliana] | - | - | 9.0e-08 | 71% |
| FL-Next | Isoform 2 of Type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2 OS=Arabidopsis thaliana GN=CVP2 | - | - | 0.0 | 69% |
| Sma3 | Type I inositol polyphosphate 5-phosphatase, putative | - | - | 2.633e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Inositol-polyphosphate 5-phosphatase. | EC:3.1.3.56 | - | 4.827e-08 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Inositol phosphate metabolism | 00562 | 4.827e-08 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.827e-08 | % | |
| Sma3 | Phosphatidylinositol signaling system | 04070 | 4.827e-08 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g05470; At2g32010; At3g63240; At3g63240/F16M2_90; CVP2; F16M2_90; POPTRDRAFT_419137; RCOM_0731120; RCOM_0911520; T25N20.12; ipp4; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | inositol or phosphatidylinositol phosphatase activity | GO:0004437 | Molecular Function | 0.0 | - |
| Sma3 | inositol-polyphosphate 5-phosphatase activity | GO:0004445 | Molecular Function | 0.0 | - |
| Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
| Sma3 | procambium histogenesis | GO:0010067 | Biological Process | 0.0 | - |
| Sma3 | leaf vascular tissue pattern formation | GO:0010305 | Biological Process | 0.0 | - |
| Sma3 | cotyledon vascular tissue pattern formation | GO:0010588 | Biological Process | 0.0 | - |
| Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
| Sma3 | inositol trisphosphate metabolic process | GO:0032957 | Biological Process | 0.0 | - |
| Sma3 | inositol phosphate dephosphorylation | GO:0046855 | Biological Process | 0.0 | - |
| Sma3 | inositol phosphate-mediated signaling | GO:0048016 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Inositol polyphosphate-related phosphatase | IPR000300 | - | 0.0 | - |
| Sma3 | YLP motif | IPR004019 | - | 0.0 | - |
| Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G63240.1 | DNAse I-like superfamily protein chr3:23364411-23366876 REVERSE LENGTH=547 | 3.0e-11 | 71% |
| RefSeq | Arabidopsis thaliana | NP_191883.2 | endonuclease/exonuclease/phosphatase domain-containing protein [Arabidopsis thaliana] | 4.0e-11 | 71% |
| RefSeq | Populus trichocarpa | XP_002307102.1 | predicted protein [Populus trichocarpa] | 2.0e-11 | 66% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LR47-2
Fln msg: Unexpected stop codon in the beginning of your sequence, Unexpected STOP codon at 3' end. Distance to subject end: 115 aas, your sequence is shorter than subject: 78 - 506
Fln protein:
P
Protein Length:
79
Fln nts:
T
Fln Alignment:
HA8LWWM01CTHTT___RVIWLGDLNYRIALCYSYTKQLVERNDWEALLESDQVLI
Q9LR47-2______________RVIWLGDLNYRIALSYRSAKALVEMQNWRALLENDQLRI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
